0001590717false00015907172023-11-092023-11-09
UNITED STATES
SECURITIES AND EXCHANGE COMMISSION
CURRENT REPORT
Pursuant to Section 13 or 15(d)
of the Securities Exchange Act of 1934
Date of Report (Date of earliest event reported): November 9, 2023 CareTrust REIT, Inc.
(Exact name of registrant as specified in its charter) | | | | | | | | |
Maryland | 001-36181 | 46-3999490 |
(State or other jurisdiction of incorporation) | (Commission File Number) | (IRS Employer Identification No.) |
Registrant’s telephone number, including area code: (949) 542-3130 | | | | | | | | | | | | | | |
| | | |
| 905 Calle Amanecer, Suite 300, San Clemente, CA | | 92673 | |
| (Address of principal executive offices) | | (Zip Code) | |
Not Applicable
(Former name or former address, if changed since last report.) Check the appropriate box below if the Form 8-K filing is intended to simultaneously satisfy the filing obligation of the registrant under any of the following provisions:
☐ Written communications pursuant to Rule 425 under the Securities Act (17 CFR 230.425)
☐ Soliciting material pursuant to Rule 14a-12 under the Exchange Act (17 CFR 240.14a-12)
☐ Pre-commencement communications pursuant to Rule 14d-2(b) under the Exchange Act (17 CFR 240.14d-2(b))
☐ Pre-commencement communications pursuant to Rule 13e-4(c) under the Exchange Act (17 CFR 240.13e-4(c))
Securities registered pursuant to Section 12(b) of the Act: | | | | | | | | |
Title of each class | Trading Symbol(s) | Name of each exchange on which registered |
Common Stock, par value $0.01 per share | CTRE | New York Stock Exchange |
| | |
Indicate by check mark whether the registrant is an emerging growth company as defined in Rule 405 of the Securities Act of 1933 (§230.405 of this chapter) or Rule 12b-2 of the Securities Exchange Act of 1934 (§240.12b-2 of this chapter).
Emerging growth company ☐
If an emerging growth company, indicate by check mark if the registrant has elected not to use the extended transition period for complying with any new or revised financial accounting standards provided pursuant to Section 13(a) of the Exchange Act. ☐
Item 2.02 Results of Operations and Financial Condition.
On November 9, 2023, CareTrust REIT, Inc. (the “Company”) issued a press release announcing its financial results for the third quarter ended September 30, 2023. A copy of the press release is attached hereto as Exhibit 99.1 and is incorporated herein by reference.
Exhibit 99.1 attached hereto shall not be deemed “filed” for purposes of Section 18 of the Securities Exchange Act of 1934, as amended (the “Exchange Act”), or otherwise subject to the liabilities of that section and shall not be incorporated by reference into any filing of the Company under the Securities Act of 1933, as amended (the “Securities Act”), or the Exchange Act, regardless of any general incorporation language in such filing, except as shall be expressly set forth by specific reference in any such filing.
Item 7.01 Regulation FD Disclosure.
A copy of the Company’s supplemental financial information for the third quarter ended September 30, 2023 is attached hereto as Exhibit 99.2 and is incorporated herein by reference. A copy of the supplemental financial information is also available on the “Investors” section of the Company’s website at www.caretrustreit.com.
Exhibit 99.2 attached hereto shall not be deemed “filed” for purposes of Section 18 of the Exchange Act or otherwise subject to the liabilities of that section and shall not be incorporated by reference into any filing of the Company under the Securities Act or the Exchange Act, regardless of any general incorporation language in such filing, except as shall be expressly set forth by specific reference in any such filing.
Item 9.01. Financial Statements and Exhibits.
| | | | | | | | |
| | |
Exhibits | | Description |
| |
| | |
| |
| | |
| | |
104 | | Cover Page Interactive Data File (embedded within the inline XBRL document) |
SIGNATURES
Pursuant to the requirements of the Securities Exchange Act of 1934, the registrant has duly caused this report to be signed on its behalf by the undersigned hereunto duly authorized.
| | | | | | | | | | | |
| | | |
Date: November 9, 2023 | | CARETRUST REIT, INC. |
| | | |
| | By: | /s/ William M. Wagner |
| | | William M. Wagner |
| | | Chief Financial Officer and Treasurer |
Exhibit 99.1
CareTrust REIT Announces Third Quarter 2023 Operating Results
Conference Call Scheduled for Friday, November 10, 2023 at 1:00 pm ET
SAN CLEMENTE, Calif., November 9, 2023 (BUSINESS WIRE) -- CareTrust REIT, Inc. (NYSE:CTRE) today reported operating results for the quarter ended September 30, 2023, as well as other recent events.
For the quarter, CareTrust REIT reported:
•97.5% of contractual rents collected;
•Net income of $8.7 million and net income per share of $0.08;
•Normalized FFO of $36.6 million and normalized FFO per share of $0.35;
•Normalized FAD of $38.8 million and normalized FAD per share of $0.37;
•A quarterly dividend of $0.28 per share, representing a payout ratio of approximately 76% on normalized FAD;
•Payment of the outstanding balance on the unsecured revolving credit facility;
•Publication of its 2022 Corporate Sustainability Report;
•Investments of $45.4 million in the quarter and $280.0 million YTD at an estimated stabilized yield of 9.9% and 9.8%, respectively, after rent ramps or rent resets under the lease are completed;
•Settlement of 16.3 million shares under its ATM Program, including both forward contract sales and direct issuances, for gross proceeds of $323.9 million;
•4.9 million shares remain outstanding on a forward basis under its ATM Program, to be settled for expected gross proceeds of $98.0 million;
•Net Debt to Annualized Normalized Run Rate EBITDA of 2.5x
CareTrust’s President and Chief Executive Officer, Dave Sedgwick, commented on the quarter’s results. “We are pleased to report continued progress on all fronts as we head into 2024. We believe our portfolio, exceptional operators, and strong balance sheet are built to take advantage of the favorable investment landscape in front of us.” Mr. Sedgwick continued, “The entire team has excelled this year in facilitating a return to significant external growth and setting the table for 2024. There has been a continual flow of deals crossing our desk that we expect will continue in 2024. The investment pipeline today is roughly $175 million, not including larger portfolio deals we regularly review.”
The Company updated its portfolio management activity. After completing the sale of one seniors housing property in October, the Company has two seniors housing properties, one skilled nursing facility, and one portfolio of 11 skilled nursing facilities held for sale. With respect to portfolio performance in the quarter, the Company's reported EBITDARM and EBITDAR lease coverage, excluding Provider Relief Funds, improved to 2.75x and 2.16x, respectively. Based on preliminary operator reports, skilled nursing and seniors housing occupancy slightly increased in August 2023 compared to June 2023 (excluding properties held for sale) to 76.5% from 75.9% and to 75.5% from 75.2%, respectively.
Financial Results for Quarter Ended September 30, 2023
Chief Financial Officer, Bill Wagner, reported that, for the third quarter, CareTrust reported net income of $8.7 million, or $0.08 per diluted weighted-average common share, normalized FFO of $36.6 million, or $0.35 per diluted weighted-average common share, and normalized FAD of $38.8 million, or $0.37 per diluted weighted-average common share.
Liquidity
As of quarter end, CareTrust reported net debt-to-annualized normalized run rate EBITDA of 2.5x, which is below the Company's target leverage range of 4.0x to 5.0x, and a net debt-to-enterprise value of approximately 16.8%. Mr. Wagner stated that, as of today, the Company has no borrowings outstanding on its $600 million revolving credit line, with no scheduled debt maturities prior to 2026. He also disclosed that CareTrust currently has approximately $36 million in cash on hand. He further noted that the Company had $496.0 million in available authorization remaining on its at-the-market equity program as of September 30, 2023. During the period July 1, 2023 to November 8, 2023, the Company settled 12.8 million shares outstanding under ATM forward contracts at a weighted average sales price of $19.85 for gross proceeds of $253.5 million. In addition, during that same period, CareTrust sold 5.4 million shares in direct sales under the ATM Program at a weighted average sales price of $20.03 for gross proceeds of $108.0 million. As of November 8, 2023, 3.0 million shares of common stock at a weighted average initial sales price of $19.99 per share, before commissions and offering expenses, remain outstanding under ATM forward contracts. "With substantial availability on our revolver, and equity markets readily accessible to us at present, we continue to have a wide range of capital options for funding our opportunistic growth strategy," said Mr. Wagner.
Dividend Maintained
During the quarter, CareTrust declared a quarterly dividend of $0.28 per common share. On an annualized basis, the payout ratio was approximately 80% based on third quarter 2023 normalized FFO, and 76% based on normalized FAD.
Conference Call
A conference call will be held on Friday, November 10, 2023, at 1:00 p.m. Eastern Time (10:00 a.m. Pacific Time), during which CareTrust’s management will discuss third quarter results, recent developments and other matters. The toll-free dial-in number is 1 (888) 510-2379 or toll dial-in number is 1 (646) 960-0691 and the conference ID number is 6808360. To listen to the call online, or to view any financial or other statistical information required by SEC Regulation G, please visit the Investors section of the CareTrust REIT website at http://investor.caretrustreit.com. This call will be recorded, and will be available for replay via the website for 30 days following the call.
About CareTrustTM
CareTrust REIT, Inc. is a self-administered, publicly-traded real estate investment trust engaged in the ownership, acquisition, development and leasing of skilled nursing, seniors housing and other healthcare-related properties. With a nationwide portfolio of long-term net-leased properties, and a growing portfolio of quality operators leasing them, CareTrust REIT is pursuing both external and organic growth opportunities across the United States. More information about CareTrust REIT is available at www.caretrustreit.com.
Safe Harbor Statement under the Private Securities Litigation Reform Act of 1995:
This press release contains, and the related conference call will include, forward-looking statements within the meaning of the Private Securities Litigation Reform Act of 1995. Forward-looking statements include all statements that are not historical statements of fact and statements regarding the Company’s intent, belief or expectations, including, but not limited to, statements regarding the following: future financial and financing plans; strategies related to the Company's business and its portfolio, including acquisition opportunities and disposition plans; growth prospects; operating and financial performance; expectations regarding the settlement of ATM forward contracts and the making of distributions and payment of dividends; and the performance of the Company’s tenants and operators and their respective facilities.
Words such as “anticipate,” “believe,” “could,” “expect,” “estimate,” “intend,” “may,” “plan,” “seek,” “should,” “will,” “would,” and similar expressions, or the negative of these terms, are intended to identify such forward-looking statements, though not all forward-looking statements contain these identifying words. The Company’s forward-looking statements are based on management’s current expectations and beliefs, and are subject to a number of risks and uncertainties that could lead to actual results differing materially from those projected, forecasted or expected. Although the Company believes that the assumptions underlying these forward-looking statements are reasonable, they are not guarantees and the Company can give no assurance that its expectations will be attained. Factors which could have a material adverse effect on the Company’s operations and future prospects or which could cause actual results to differ materially from expectations include, but are not limited to: (i) the impact of possible additional surges of COVID-19 infections or the risk of other pandemics, epidemics or infectious disease outbreaks, measures taken to prevent the spread of such outbreaks and the related impact on our business or the businesses of our tenants; (ii) the ability and willingness of our tenants to meet and/or perform their obligations under the triple-net leases we have entered into with them, including, without limitation, their respective obligations to indemnify, defend and hold us harmless from and against various claims, litigation and liabilities; (iii) the risk that we may have to incur additional impairment charges related to our assets held for sale if we are unable to sell such assets at the prices we expect; (iv) the ability of our tenants to comply with applicable laws, rules and regulations in the operation of the properties we lease to them; (v) the ability and willingness of our tenants to renew their leases with us upon their expiration, and the ability to reposition our properties on the same or better terms in the event of nonrenewal or in the event we replace an existing tenant, as well as any obligations, including indemnification obligations, we may incur in connection with the replacement of an existing tenant; (vi) the availability of and the ability to identify (a) tenants who meet our credit and operating standards, and (b) suitable acquisition opportunities, and the ability to acquire and lease the respective properties to such tenants on favorable terms; (vii) the ability to generate sufficient cash flows to service our outstanding indebtedness; (viii) access to debt and equity capital markets; (ix) fluctuating interest rates and inflation; (x) the ability to retain our key management personnel; (xi) the ability to maintain our status as a real estate investment trust (“REIT”); (xii) changes in the U.S. tax law and other state, federal or local laws, whether or not specific to REITs; (xiii) other risks inherent in the real estate business, including potential liability relating to environmental matters and illiquidity of real estate investments; and (xiv) additional factors included in our Annual Report on Form 10-K for the year ended December 31, 2022 and Quarterly Reports on Form 10-Q for the quarters ended March 31, 2023, June 30, 2023 and September 30, 2023, including in the sections entitled “Risk Factors” in Item 1A of such reports, as such risk factors may be amended, supplemented or superseded from time to time by other reports we file with the SEC.
This press release and the related conference call provides information about the Company's financial results as of and for the quarter ended September 30, 2023 and is provided as of the date hereof, unless specifically stated otherwise. The Company expressly disclaims any obligation to update or revise any information in this press release or the related conference call (and replays thereof), including forward-looking statements, whether to reflect any change in the Company’s expectations, any change in events, conditions or circumstances, or otherwise.
As used in this press release or the related conference call, unless the context requires otherwise, references to “CTRE,” "CareTrust," “CareTrust REIT” or the “Company” refer to CareTrust REIT, Inc. and its consolidated subsidiaries. GAAP refers to generally accepted accounting principles in the United States of America.
Contact:
CareTrust REIT, Inc.
(949) 542-3130
ir@caretrustreit.com
| | | | | | | | | | | | | | | | | | | | | | | | | | |
CARETRUST REIT, INC. |
CONSOLIDATED STATEMENTS OF OPERATIONS |
(in thousands, except per share data) |
(Unaudited) |
| | For the Three Months Ended September 30, | | For the Nine Months Ended September 30, |
| | 2023 | | 2022 | | 2023 | | 2022 |
| | | | | | |
Revenues: | | | | | | | |
| Rental income | $ | 51,218 | | | $ | 47,018 | | | $ | 145,126 | | | $ | 139,831 | |
| | | | | | | | |
| | | | | | | | |
| Interest and other income | 4,659 | | | 3,275 | | | 12,910 | | | 4,491 | |
| Total revenues | 55,877 | | | 50,293 | | | 158,036 | | | 144,322 | |
Expenses: | | | | | | | |
| Depreciation and amortization | 13,034 | | | 12,256 | | | 37,988 | | | 38,390 | |
| Interest expense | 11,750 | | | 8,355 | | | 32,617 | | | 20,400 | |
| | | | | | | | |
| Property taxes | 2,167 | | | 691 | | | 4,437 | | | 3,365 | |
| | | | | | | | |
| Impairment of real estate investments | 8,232 | | | 12,322 | | | 31,510 | | | 73,706 | |
| | | | | | | | |
| Provision for loan losses, net | — | | | — | | | — | | | 3,844 | |
| Property operating expenses | 1,239 | | | 3,808 | | | 2,860 | | | 4,344 | |
| | | | | | | | |
| General and administrative | 5,519 | | | 5,159 | | | 15,298 | | | 15,352 | |
| Total expenses | 41,941 | | | 42,591 | | | 124,710 | | | 159,401 | |
Other (loss) income: | | | | | | | |
| | | | | | | | |
| (Loss) gain on sale of real estate, net | — | | | (2,287) | | | 1,958 | | | (2,101) | |
| | | | | | | | |
| Unrealized losses on other real estate related investments, net | (5,251) | | | (4,706) | | | (7,856) | | | (4,706) | |
| Total other (loss) income | (5,251) | | | (6,993) | | | (5,898) | | | (6,807) | |
Net income (loss) | 8,685 | | | 709 | | | 27,428 | | | (21,886) | |
| Net loss attributable to noncontrolling interests | (11) | | | — | | | (11) | | | — | |
Net income (loss) attributable to CareTrust REIT, Inc. | $ | 8,696 | | | $ | 709 | | | $ | 27,439 | | | $ | (21,886) | |
| | | | | | | | |
Earnings (loss) per common share attributable to CareTrust REIT, Inc.: | | | | | | | |
| Basic | $ | 0.08 | | | $ | 0.01 | | | $ | 0.27 | | | $ | (0.23) | |
| Diluted | $ | 0.08 | | | $ | 0.01 | | | $ | 0.27 | | | $ | (0.23) | |
| | | | | | | | |
Weighted-average number of common shares: | | | | | | | |
| Basic | 104,011 | | | 96,605 | | | 100,748 | | | 96,527 | |
| Diluted | 104,311 | | | 96,625 | | | 100,918 | | | 96,527 | |
| | | | | | | | |
Dividends declared per common share | $ | 0.28 | | | $ | 0.275 | | | $ | 0.84 | | | $ | 0.825 | |
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | |
CARETRUST REIT, INC. |
RECONCILIATIONS OF NET INCOME (LOSS) TO NON-GAAP FINANCIAL MEASURES |
(in thousands) |
(Unaudited) |
| | | Three Months Ended September 30, | | Nine Months Ended September 30, |
| | | 2023 | | 2022 | | 2023 | | 2022 |
| | | | | | | | | |
Net income (loss) attributable to CareTrust REIT, Inc. | | $ | 8,696 | | | $ | 709 | | | $ | 27,439 | | | $ | (21,886) | |
| Depreciation and amortization | | 13,034 | | | 12,256 | | | 37,988 | | | 38,390 | |
| Interest expense | | 11,750 | | | 8,355 | | | 32,617 | | | 20,400 | |
| Amortization of stock-based compensation | | 1,519 | | | 1,380 | | | 3,379 | | | 4,295 | |
EBITDA attributable to CareTrust REIT, Inc. | | 34,999 | | | 22,700 | | | 101,423 | | | 41,199 | |
| | | | | | | | | |
| | | | | | | | | |
| Impairment of real estate investments | | 8,232 | | | 12,322 | | | 31,510 | | | 73,706 | |
| Provision for loan losses, net | | — | | | — | | | — | | | 3,844 | |
| Provision for doubtful accounts and lease restructuring | | — | | | — | | | — | | | 977 | |
| | | | | | | | | |
| | | | | | | | | |
| Property operating expenses | | 1,416 | | | 3,821 | | | 3,381 | | | 5,683 | |
| Loss (gain) on sale of real estate, net | | — | | | 2,287 | | | (1,958) | | | 2,101 | |
| | | | | | | | | |
| | | | | | | | | |
| Unrealized losses on other real estate related investments, net | | 5,251 | | | 4,706 | | | 7,856 | | | 4,706 | |
Normalized EBITDA attributable to CareTrust REIT, Inc. | | 49,898 | | | 45,836 | | | $ | 142,212 | | | $ | 132,216 | |
| Full impact of quarterly investments[1] | | 607 | | | 593 | | | | | |
Normalized Run Rate EBITDA attributable to CareTrust REIT, Inc. | | $ | 50,505 | | | $ | 46,429 | | | | | |
| | | | | | | | | |
Net income (loss) attributable to CareTrust REIT, Inc. | | $ | 8,696 | | | $ | 709 | | | $ | 27,439 | | | $ | (21,886) | |
| Real estate related depreciation and amortization | | 13,028 | | | 12,251 | | | 37,973 | | | 38,375 | |
| Impairment of real estate investments | | 8,232 | | | 12,322 | | | 31,510 | | | 73,706 | |
| Loss (gain) on sale of real estate, net | | — | | | 2,287 | | | (1,958) | | | 2,101 | |
| | | | | | | | | |
Funds from Operations (FFO) attributable to CareTrust REIT, Inc. | | 29,956 | | | 27,569 | | | 94,964 | | | 92,296 | |
| | | | | | | | | |
| Provision for loan losses, net | | — | | | — | | | — | | | 3,844 | |
| Provision for doubtful accounts and lease restructuring | | — | | | — | | | — | | | 977 | |
| | | | | | | | | |
| | | | | | | | | |
| Property operating expenses | | 1,416 | | | 3,821 | | | 3,381 | | | 5,683 | |
| | | | | | | | | |
| | | | | | | | | |
| | | | | | | | | |
| | | | | | | | | |
| Unrealized losses on other real estate related investments, net | | 5,251 | | | 4,706 | | | 7,856 | | | 4,706 | |
Normalized FFO attributable to CareTrust REIT, Inc. | | $ | 36,623 | | | $ | 36,096 | | | $ | 106,201 | | | $ | 107,506 | |
| | | | | | | | | |
NET DEBT TO ANNUALIZED NORMALIZED RUN RATE EBITDA RECONCILIATION |
(in thousands) |
(Unaudited) |
| | | Three Months Ended September 30, | | | | |
| | | 2023 | | 2022 | | | | |
| Total debt | | $ | 600,000 | | | $ | 780,000 | | | | | |
| Cash, cash equivalents | | (3,485) | | | (4,861) | | | | | |
| Net proceeds from ATM forward[2] | | (96,132) | | | — | | | | | |
Net Debt | | $ | 500,383 | | | $ | 775,139 | | | | | |
Annualized Normalized Run Rate EBITDA attributable to CareTrust REIT, Inc.[3] | | $ | 202,020 | | | $ | 185,716 | | | | | |
Net Debt to Annualized Normalized Run Rate EBITDA attributable to CareTrust REIT, Inc. | | 2.5x | | 4.2x | | | | |
[1] Quarterly adjustments give effect to the investments completed during the three months ended for the respective period as though such investments were completed as of the beginning of the period. |
[2] Net proceeds from the future expected settlement of shares sold under equity forward contracts through the Company's ATM program. |
[3] Annualized Normalized Run Rate EBITDA is calculated as Normalized Run Rate EBITDA attributable to CareTrust REIT, Inc. for the quarter multiplied by four (4). |
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | |
CARETRUST REIT, INC. |
RECONCILIATIONS OF NET INCOME (LOSS) TO NON-GAAP FINANCIAL MEASURES (continued) |
(in thousands, except per share data) |
(Unaudited) |
| | | Three Months Ended September 30, | | Nine Months Ended September 30, |
| | | 2023 | | 2022 | | 2023 | | 2022 |
| | | | | | | | | |
Net income (loss) attributable to CareTrust REIT, Inc. | | $ | 8,696 | | | $ | 709 | | | $ | 27,439 | | | $ | (21,886) | |
| Real estate related depreciation and amortization | | 13,028 | | | 12,251 | | | 37,973 | | | 38,375 | |
| Amortization of deferred financing fees | | 609 | | | 520 | | | 1,826 | | | 1,560 | |
| Amortization of stock-based compensation | | 1,519 | | | 1,380 | | | 3,379 | | | 4,295 | |
| Straight-line rental income | | 7 | | | (3) | | | 21 | | | (14) | |
| Impairment of real estate investments | | 8,232 | | | 12,322 | | | 31,510 | | | 73,706 | |
| Loss (gain) on sale of real estate, net | | — | | | 2,287 | | | (1,958) | | | 2,101 | |
| | | | | | | | | |
Funds Available for Distribution (FAD) attributable to CareTrust REIT, Inc. | | 32,091 | | | 29,466 | | | 100,190 | | | 98,137 | |
| | | | | | | | | |
| Provision for loan losses, net | | — | | | — | | | — | | | 3,844 | |
| Provision for doubtful accounts and lease restructuring | | — | | | — | | | — | | | 977 | |
| | | | | | | | | |
| | | | | | | | | |
| Property operating expenses | | 1,416 | | | 3,821 | | | 3,381 | | | 5,683 | |
| | | | | | | | | |
| | | | | | | | | |
| | | | | | | | | |
| | | | | | | | | |
| Unrealized losses on other real estate related investments, net | | 5,251 | | | 4,706 | | | 7,856 | | | 4,706 | |
Normalized FAD attributable to CareTrust REIT, Inc. | | $ | 38,758 | | | $ | 37,993 | | | $ | 111,427 | | | $ | 113,347 | |
| | | | | | | | | |
FFO attributable to CareTrust REIT, Inc., per share | | $ | 0.29 | | | $ | 0.28 | | | $ | 0.94 | | | $ | 0.95 | |
Normalized FFO attributable to CareTrust REIT, Inc., per share | | $ | 0.35 | | | $ | 0.37 | | | $ | 1.05 | | | $ | 1.11 | |
| | | | | | | | | |
FAD attributable to CareTrust REIT, Inc., per share | | $ | 0.31 | | | $ | 0.30 | | | $ | 0.99 | | | $ | 1.01 | |
Normalized FAD attributable to CareTrust REIT, Inc., per share | | $ | 0.37 | | | $ | 0.39 | | | $ | 1.10 | | | $ | 1.17 | |
| | | | | | | | | |
| Diluted weighted average shares outstanding [1] | | 104,422 | | | 96,752 | | | 101,010 | | | 96,709 | |
| | | | | | | | | |
| [1] For the periods presented, the diluted weighted average shares have been calculated using the treasury stock method. |
| | | | | | | | | | | | | | | | | |
CARETRUST REIT, INC. |
CONSOLIDATED STATEMENTS OF OPERATIONS - 5 QUARTER TREND |
(in thousands, except per share data) |
(Unaudited) |
| Quarter | Quarter | Quarter | Quarter | Quarter |
| Ended | Ended | Ended | Ended | Ended |
| September 30, 2022 | December 31, 2022 | March 31, 2023 | June 30, 2023 | September 30, 2023 |
Revenues: | | | | | |
Rental income | $ | 47,018 | | $ | 47,675 | | $ | 46,163 | | $ | 47,745 | | $ | 51,218 | |
| | | | | |
| | | | | |
Interest and other income | 3,275 | | 4,135 | | 4,443 | | 3,808 | | 4,659 | |
Total revenues | 50,293 | | 51,810 | | 50,606 | | 51,553 | | 55,877 | |
Expenses: | | | | | |
Depreciation and amortization | 12,256 | | 11,926 | | 12,238 | | 12,716 | | 13,034 | |
Interest expense | 8,355 | | 9,608 | | 9,827 | | 11,040 | | 11,750 | |
| | | | | |
Property taxes | 691 | | 968 | | 880 | | 1,390 | | 2,167 | |
| | | | | |
Impairment of real estate investments | 12,322 | | 5,356 | | 1,886 | | 21,392 | | 8,232 | |
| | | | | |
Property operating expenses | 3,808 | | 695 | | 963 | | 658 | | 1,239 | |
| | | | | |
General and administrative | 5,159 | | 4,813 | | 5,061 | | 4,718 | | 5,519 | |
Total expenses | 42,591 | | 33,366 | | 30,855 | | 51,914 | | 41,941 | |
Other loss: | | | | |
| | | | | |
| | | | | |
(Loss) gain on sale of real estate, net | (2,287) | | (1,668) | | (70) | | 2,028 | | — | |
Unrealized losses on other real estate related investments, net | (4,706) | | (2,396) | | (454) | | (2,151) | | (5,251) | |
Total other loss | (6,993) | | (4,064) | | (524) | | (123) | | (5,251) | |
Net income (loss) | 709 | | 14,380 | | 19,227 | | (484) | | 8,685 | |
Net loss attributable to noncontrolling interests | — | | — | | — | | — | | (11) | |
Net income (loss) attributable to CareTrust REIT, Inc. | $ | 709 | | $ | 14,380 | | $ | 19,227 | | $ | (484) | | $ | 8,696 | |
| | | | | |
Diluted earnings (loss) attributable to CareTrust REIT, Inc., per share | $ | 0.01 | | $ | 0.15 | | $ | 0.19 | | $ | (0.01) | | $ | 0.08 | |
| | | | | |
Diluted weighted average shares outstanding | 96,625 | | 97,272 | | 99,087 | | 99,117 | | 104,311 | |
| | | | | | | | | | | | | | | | | |
CARETRUST REIT, INC. |
RECONCILIATIONS OF NET INCOME (LOSS) TO NON-GAAP FINANCIAL MEASURES - 5 QUARTER TREND |
(in thousands) |
(Unaudited) |
| Quarter | Quarter | Quarter | Quarter | Quarter |
| Ended | Ended | Ended | Ended | Ended |
| September 30, 2022 | December 31, 2022 | March 31, 2023 | June 30, 2023 | September 30, 2023 |
| | | | | |
Net income (loss) attributable to CareTrust REIT, Inc. | $ | 709 | | $ | 14,380 | | $ | 19,227 | | $ | (484) | | $ | 8,696 | |
Depreciation and amortization | 12,256 | | 11,926 | | 12,238 | | 12,716 | | 13,034 | |
Interest expense | 8,355 | | 9,608 | | 9,827 | | 11,040 | | 11,750 | |
Amortization of stock-based compensation | 1,380 | | 1,463 | | 936 | | 924 | | 1,519 | |
EBITDA attributable to CareTrust REIT, Inc. | 22,700 | | 37,377 | | 42,228 | | 24,196 | | 34,999 | |
| | | | | |
| | | | | |
Impairment of real estate investments | 12,322 | | 5,356 | | 1,886 | | 21,392 | | 8,232 | |
| | | | | |
Provision for doubtful accounts and lease restructuring | — | | 390 | | — | | — | | — | |
| | | | | |
| | | | | |
Property operating expenses | 3,821 | | 914 | | 1,134 | | 831 | | 1,416 | |
| | | | | |
Loss (gain) on sale of real estate, net | 2,287 | | 1,668 | | 70 | | (2,028) | | — | |
| | | | | |
| | | | | |
Unrealized losses on other real estate related investments, net | 4,706 | | 2,396 | | 454 | | 2,151 | | 5,251 | |
Normalized EBITDA attributable to CareTrust REIT, Inc. | $ | 45,836 | | $ | 48,101 | | $ | 45,772 | | $ | 46,542 | | $ | 49,898 | |
| | | | | |
Net income (loss) attributable to CareTrust REIT, Inc. | $ | 709 | | $ | 14,380 | | $ | 19,227 | | $ | (484) | | $ | 8,696 | |
Real estate related depreciation and amortization | 12,251 | | 11,921 | | 12,233 | | 12,712 | | 13,028 | |
Impairment of real estate investments | 12,322 | | 5,356 | | 1,886 | | 21,392 | | 8,232 | |
Loss (gain) on sale of real estate, net | 2,287 | | 1,668 | | 70 | | (2,028) | | — | |
| | | | | |
Funds from Operations (FFO) attributable to CareTrust REIT, Inc. | 27,569 | | 33,325 | | 33,416 | | 31,592 | | 29,956 | |
| | | | | |
| | | | | |
| | | | | |
| | | | | |
Provision for doubtful accounts and lease restructuring | — | | 390 | | — | | — | | — | |
| | | | | |
| | | | | |
Property operating expenses | 3,821 | | 914 | | 1,134 | | 831 | | 1,416 | |
| | | | | |
| | | | | |
| | | | | |
Unrealized losses on other real estate related investments, net | 4,706 | | 2,396 | | 454 | | 2,151 | | 5,251 | |
Normalized FFO attributable to CareTrust REIT, Inc. | $ | 36,096 | | $ | 37,025 | | $ | 35,004 | | $ | 34,574 | | $ | 36,623 | |
| | | | | | | | | | | | | | | | | |
CARETRUST REIT, INC. |
RECONCILIATIONS OF NET INCOME (LOSS) TO NON-GAAP FINANCIAL MEASURES - 5 QUARTER TREND (continued) |
(in thousands, except per share data) |
(Unaudited) |
| Quarter | Quarter | Quarter | Quarter | Quarter |
| Ended | Ended | Ended | Ended | Ended |
| September 30, 2022 | December 31, 2022 | March 31, 2023 | June 30, 2023 | September 30, 2023 |
| | | | | |
Net income (loss) available to common stockholders | $ | 709 | | $ | 14,380 | | $ | 19,227 | | $ | (484) | | $ | 8,696 | |
Real estate related depreciation and amortization | 12,251 | | 11,921 | | 12,233 | | 12,712 | | 13,028 | |
Amortization of deferred financing fees | 520 | | 535 | | 609 | | 608 | | 609 | |
Amortization of stock-based compensation | 1,380 | | 1,463 | | 936 | | 924 | | 1,519 | |
Straight-line rental income | (3) | | (3) | | 7 | | 7 | | 7 | |
Impairment of real estate investments | 12,322 | | 5,356 | | 1,886 | | 21,392 | | 8,232 | |
Loss (gain) on sale of real estate, net | 2,287 | | 1,668 | | 70 | | (2,028) | | — | |
| | | | | |
Funds Available for Distribution (FAD) attributable to CareTrust REIT, Inc. | 29,466 | | 35,320 | | 34,968 | | 33,131 | | 32,091 | |
| | | | | |
| | | | | |
| | | | | |
| | | | | |
Provision for doubtful accounts and lease restructuring | — | | 390 | | — | | — | | — | |
| | | | | |
| | | | | |
Property operating expenses | 3,821 | | 914 | | 1,134 | | 831 | | 1,416 | |
| | | | | |
| | | | | |
Unrealized losses on other real estate related investments, net | 4,706 | | 2,396 | | 454 | | 2,151 | | 5,251 | |
Normalized FAD attributable to CareTrust REIT, Inc. | $ | 37,993 | | $ | 39,020 | | $ | 36,556 | | $ | 36,113 | | $ | 38,758 | |
| | | | | |
FFO attributable to CareTrust REIT, Inc., per share | $ | 0.28 | | $ | 0.34 | | $ | 0.34 | | $ | 0.32 | | $ | 0.29 | |
Normalized FFO attributable to CareTrust REIT, Inc., per share | $ | 0.37 | | $ | 0.38 | | $ | 0.35 | | $ | 0.35 | | $ | 0.35 | |
| | | | | |
FAD attributable to CareTrust REIT, Inc., per share | $ | 0.30 | | $ | 0.36 | | $ | 0.35 | | $ | 0.33 | | $ | 0.31 | |
Normalized FAD attributable to CareTrust REIT, Inc., per share | $ | 0.39 | | $ | 0.40 | | $ | 0.37 | | $ | 0.36 | | $ | 0.37 | |
| | | | | |
Diluted weighted average shares outstanding [1] | 96,752 | | 97,408 | | 99,195 | | 99,360 | | 104,422 | |
| | | | | |
[1] For the periods presented, the diluted weighted average shares have been calculated using the treasury stock method. |
| | | | | | | | | | | | | | | | | | | | |
CARETRUST REIT, INC. |
CONSOLIDATED BALANCE SHEETS |
(in thousands) |
(Unaudited) |
| | | | September 30, 2023 | | December 31, 2022 |
Assets: | | | | |
Real estate investments, net | $ | 1,536,048 | | | $ | 1,421,410 | |
Other real estate related investments, at fair value (including accrued interest of $1,449 as of September 30, 2023 and $1,320 as of December 31, 2022) | 181,175 | | | 156,368 | |
Assets held for sale, net | 21,341 | | | 12,291 | |
Cash and cash equivalents | 3,485 | | | 13,178 | |
| | | |
Accounts and other receivables | 383 | | | 416 | |
Prepaid expenses and other assets, net | 20,684 | | | 11,690 | |
Deferred financing costs, net | 4,448 | | | 5,428 | |
| | | Total assets | $ | 1,767,564 | | | $ | 1,620,781 | |
| | | | | | |
Liabilities and Equity: | | | |
Senior unsecured notes payable, net | $ | 395,816 | | | $ | 395,150 | |
Senior unsecured term loan, net | 199,507 | | | 199,348 | |
Unsecured revolving credit facility | — | | | 125,000 | |
Accounts payable, accrued liabilities and deferred rent liabilities | 28,854 | | | 24,360 | |
Dividends payable | 32,403 | | | 27,550 | |
| | | Total liabilities | 656,580 | | | 771,408 | |
| | | | | | |
Equity: | | | | |
Common stock | 1,154 | | | 990 | |
Additional paid-in capital | 1,566,161 | | | 1,245,337 | |
Cumulative distributions in excess of earnings | (457,393) | | | (396,954) | |
| | | Total stockholders' equity | 1,109,922 | | | 849,373 | |
Non-controlling interests | 1,062 | | | — | |
| | | Total equity | 1,110,984 | | | 849,373 | |
| | | Total liabilities and equity | $ | 1,767,564 | | | $ | 1,620,781 | |
| | | | | | | | | | | |
CARETRUST REIT, INC. |
CONSOLIDATED STATEMENTS OF CASH FLOWS |
(in thousands) |
(Unaudited) |
| For the Nine Months Ended September 30, |
| 2023 | | 2022 |
Cash flows from operating activities: | | | |
Net income (loss) | $ | 27,428 | | | $ | (21,886) | |
Adjustments to reconcile net income (loss) to net cash provided by operating activities: | | | |
Depreciation and amortization (including below-market ground leases) | 38,031 | | | 38,437 | |
Amortization of deferred financing costs | 1,826 | | | 1,560 | |
| | | |
Unrealized losses on other real estate related investments, net | 7,856 | | | 4,706 | |
Amortization of stock-based compensation | 3,379 | | | 4,295 | |
Straight-line rental income | 21 | | | (14) | |
Adjustment for collectibility of rental income | — | | | 977 | |
Noncash interest income | (129) | | | (1,063) | |
(Gain) loss on sale of real estate, net | (1,958) | | | 2,101 | |
| | | |
| | | |
Impairment of real estate investments | 31,510 | | | 73,706 | |
Provision for loan losses, net | — | | | 3,844 | |
| | | |
Change in operating assets and liabilities: | | | |
Accounts and other receivables | 11 | | | 648 | |
Prepaid expenses and other assets, net | (68) | | | (2,082) | |
Accounts payable, accrued liabilities and deferred rent liabilities | 4,189 | | | 5,443 | |
Net cash provided by operating activities | 112,096 | | | 110,672 | |
Cash flows from investing activities: | | | |
Acquisitions of real estate, net of deposits applied | (198,565) | | | (21,915) | |
Purchases of equipment, furniture and fixtures and improvements to real estate | (9,139) | | | (5,475) | |
| | | |
Investment in real estate related investments and other loans receivable | (50,693) | | | (149,650) | |
| | | |
Principal payments received on real estate related investments and other loans receivable | 15,703 | | | 1,166 | |
| | | |
Escrow deposits for potential acquisitions of real estate | (4,075) | | | — | |
Net proceeds from sales of real estate | 14,464 | | | 34,115 | |
Net cash used in investing activities | (232,305) | | | (141,759) | |
Cash flows from financing activities: | | | |
Proceeds from the issuance of common stock, net | 319,032 | | | — | |
| | | |
| | | |
Borrowings under unsecured revolving credit facility | 185,000 | | | 145,000 | |
| | | |
Payments on unsecured revolving credit facility | (310,000) | | | (45,000) | |
| | | |
| | | |
| | | |
| | | |
Payments of deferred financing costs | (21) | | | — | |
Net-settle adjustment on restricted stock | (1,479) | | | (4,469) | |
Dividends paid on common stock | (83,089) | | | (79,478) | |
Contributions from noncontrolling interests | 1,073 | | | — | |
Net cash provided by financing activities | 110,516 | | | 16,053 | |
Net decrease in cash and cash equivalents | (9,693) | | | (15,034) | |
Cash and cash equivalents as of the beginning of period | 13,178 | | | 19,895 | |
Cash and cash equivalents as of the end of period | $ | 3,485 | | | $ | 4,861 | |
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | |
CARETRUST REIT, INC. |
DEBT SUMMARY |
(dollars in thousands) |
(Unaudited) |
| | | | | | | | | | | |
| | | | | September 30, 2023 |
| Interest | | Maturity | | | | % of | | Deferred | | Net Carrying |
Debt | Rate | | Date | | Principal | | Principal | | Loan Costs | | Value |
| | | | | | | | | | | |
Fixed Rate Debt | | | | | | | | | | | |
| | | | | | | | | | | |
Senior unsecured notes payable | 3.875 | % | | 2028 | | $ | 400,000 | | | 66.7 | % | | $ | (4,184) | | | $ | 395,816 | |
Floating Rate Debt | | | | | | | | | | | |
| | | | | | | | | | | |
Senior unsecured term loan | 6.925 | % | [1] | 2026 | | 200,000 | | | 33.3 | % | | (493) | | | 199,507 | |
| | | | | | | | | | | |
| | | | | | | | | | | |
| | | | | | | | | | | |
Total Debt | 4.892 | % | | | | $ | 600,000 | | | 100.0 | % | | $ | (4,677) | | | $ | 595,323 | |
| | | | | | | | | | | |
[1] Funds can be borrowed at applicable SOFR plus 1.50% to 2.20% or at the Base Rate (as defined) plus 0.50% to 1.20%. |
|
|
|
Non-GAAP Financial Measures
EBITDA attributable to CareTrust REIT, Inc. represents net income (loss) attributable to CareTrust REIT, Inc. before interest expense (including amortization of deferred financing costs), amortization of stock-based compensation, and depreciation and amortization. Normalized EBITDA attributable to CareTrust REIT, Inc. represents EBITDA attributable to CareTrust REIT, Inc. as further adjusted to eliminate the impact of certain items that the Company does not consider indicative of core operating performance, such as recovery of previously reversed rent, lease termination revenue, property operating expenses, gains or losses from dispositions of real estate, real estate impairment charges, provision for loan losses, non-routine transaction costs, loss on extinguishment of debt, unrealized loss on other real estate related investments and provision for doubtful accounts and lease restructuring, as applicable. EBITDA attributable to CareTrust REIT, Inc. and Normalized EBITDA attributable to CareTrust REIT, Inc. do not represent cash flows from operations or net income as defined by GAAP and should not be considered an alternative to those measures in evaluating the Company’s liquidity or operating performance. EBITDA attributable to CareTrust REIT, Inc. and Normalized EBITDA attributable to CareTrust REIT, Inc. do not purport to be indicative of cash available to fund future cash requirements, including the Company’s ability to fund capital expenditures or make payments on its indebtedness. Further, the Company’s computation of EBITDA and Normalized EBITDA may not be comparable to EBITDA and Normalized EBITDA reported by other REITs.
Funds from Operations (“FFO”), as defined by the National Association of Real Estate Investment Trusts (“Nareit”), and Funds Available for Distribution (“FAD”) are important non-GAAP supplemental measures of operating performance for a REIT. Because the historical cost accounting convention used for real estate assets requires straight-line depreciation except on land, such accounting presentation implies that the value of real estate assets diminishes predictably over time. Since real estate values have historically risen or fallen with market and other conditions, presentations of operating results for a REIT that uses historical cost accounting for depreciation could be less informative. Thus, Nareit created FFO as a supplemental measure of operating performance for REITs that excludes historical cost depreciation and amortization, among other items, from net income, as defined by GAAP.
FFO is defined by Nareit as net income computed in accordance with GAAP, excluding gains or losses from dispositions of real estate investments, real estate related depreciation and amortization and real estate impairment charges, and adjustments for unconsolidated partnerships and joint ventures. The Company computes FFO attributable to CareTrust REIT, Inc. in accordance with Nareit’s definition.
FAD attributable to CareTrust REIT, Inc. is defined as FFO attributable to CareTrust REIT, Inc. excluding noncash income and expenses, such as amortization of stock-based compensation, amortization of deferred financing fees and the effects of straight-line rent. The Company considers FAD attributable to CareTrust REIT, Inc. to be a useful supplemental measure to evaluate the Company’s operating results excluding these income and expense items to help investors, analysts and other interested parties compare the operating performance of the Company between periods or as compared to other companies on a more consistent basis.
In addition, the Company reports Normalized FFO attributable to CareTrust REIT, Inc. and Normalized FAD attributable to CareTrust REIT, Inc., which adjust FFO and FAD for certain revenue and expense items that the Company does not believe are indicative of its ongoing operating results, such as provision for loan losses, non-routine transaction costs, provision for doubtful accounts and lease restructuring, loss on extinguishment of debt, unrealized loss on other real estate related investments, recovery of previously reversed rent, lease termination revenue and property operating expenses. By excluding these items, investors, analysts and our management can compare Normalized FFO and Normalized FAD between periods more consistently.
While FFO, Normalized FFO, FAD and Normalized FAD are relevant and widely-used measures of operating performance among REITs, they do not represent cash flows from operations or net income as defined by GAAP and should not be considered an alternative to those measures in evaluating the Company’s liquidity or operating performance. FFO, Normalized FFO, FAD and Normalized FAD do not purport to be indicative of cash available to fund future cash requirements.
Further, the Company’s computation of FFO, Normalized FFO, FAD and Normalized FAD may not be comparable to FFO, Normalized FFO, FAD and Normalized FAD reported by other REITs that do not define FFO in accordance with the current Nareit definition or that interpret the current Nareit definition or define FAD differently than the Company does.
The Company also discloses Net Debt to Annualized Normalized Run Rate EBITDA, which compares the Company’s Net Debt as of the last day of the quarter to the Annualized Run Rate EBITDA attributable to CareTrust REIT, Inc. for the quarter. Net Debt is defined as the Company’s Total Debt as of the last day of the specified quarter adjusted to exclude the Company’s cash, cash equivalents, restricted cash and escrow deposits on acquisition of real estate as of such date as well as the net proceeds from the expected settlement of shares sold under equity forward contracts through the Company’s ATM Program that are outstanding as of such date. Normalized Run Rate EBITDA represents Normalized EBITDA, adjusted to give effect to the investments completed during the three months ended for the respective period as though such investments were completed as of the beginning of the period. Annualized Normalized Run Rate EBITDA is calculated as Normalized Run Rate EBITDA attributable to CareTrust REIT, Inc. for the specified quarter multiplied by four.
The Company believes that net income attributable to CareTrust REIT, Inc., as defined by GAAP, is the most appropriate earnings measure. The Company also believes that the use of EBITDA, Normalized EBITDA, FFO, Normalized FFO, FAD and Normalized FAD, combined with the required GAAP presentations, improves the understanding of operating results of REITs among investors and makes comparisons of operating results among such companies more meaningful. The Company considers EBITDA and Normalized EBITDA, in each case attributable to CareTrust REIT, Inc., useful in understanding the Company’s operating results independent of its capital structure, indebtedness and other charges that are not indicative of its ongoing results, thereby allowing for a more meaningful comparison of operating performance between periods and against other REITs. The Company considers FFO, Normalized FFO, FAD and Normalized FAD, in each case attributable to CareTrust REIT, Inc., to be useful measures for reviewing comparative operating and financial performance because, by excluding gains or losses from real estate dispositions, impairment charges and real estate related depreciation and amortization, and, for FAD and Normalized FAD, by excluding noncash income and expenses such as amortization of stock-based compensation, amortization of deferred financing fees, and the effects of straight-line rent, FFO, Normalized FFO, FAD and Normalized FAD can help investors compare the Company’s operating performance between periods and to other REITs. The Company believes that the disclosure of Net Debt to Annualized Normalized Run Rate EBITDA provides a useful measure to investors to evaluate the credit strength of the Company and its ability to service its debt obligations and to compare the Company’s credit strength to prior reporting periods and to other companies without the effect of charges that are not indicative of the Company’s ongoing performance or that could obscure the Company’s actual credit quality and after considering the effect of investments occurring during the period.
![logoa.jpg](https://www.sec.gov/Archives/edgar/data/1590717/000162828023038226/logoa.jpg)
!!"#
! ! "#$%!&'())*+, ! !! !-!.! /0123!4.! 3!35!! !230#3 #+6 73872#38738953873873870387387 387 3873873853 !# 30 !3 ! ! 0!+: !25232;2 !0 ;35+' ! 2# 0! !23 0!!# 52+, ## 0532-<= 2!/:>?@() 32 3 # 2 2 2.<= 20!A 2! # 3!3 3 #2!03 !#3!2.<= 0 # ! 2 5.<#= 200 23! .<#= 20! 53 20 2 # #5!302!3!2!30 5!.<#= #20 200<= !3<2=243 204 # #2.<#= 20! #!2.<#=240 .<5=!.<5= 20 0!.<5= 20#<7&B?8=.<5= ! C+$+5 33 &B?.<5= 23!20!#40#.<5#=0'&,(DE 0@2F(3GDGGH0&,(DH 4I F(3GDGFJFD3GDGF3! 7& ,8?(' 3 02320 $B5 !/< 9$B/9=+ K''"!/&B?!BL?@'3MNBL?@'3,,:3MN,,:3,'@3MN,'@3+B50!05! K''" +& K''" 2+$7,,!OH0&8 ?# 2 #+++ MK''" K''" 23403#30 K''"+P 0K''"2K''"3 !N K''" 00K''" <++32 0 !0 K''"=+ !!< BL?@'&I /#!3 BL?@'& /#!3 :0=3 2;$B/!4+ # 2#20 +6 #0# 32 #2# 0+6#! 0+ B!K3?+<9B!9= "K3?+<9"9=2; !!4 $B/4 $B/!40!+B!Q"13 $B/32 $B/12++!#+ #2 4$2FD3GDGF# 30 +65002!#0 <! !=3 0 !530 !#33 +' 3 54 37/&B387/387/&B?8 7/08/&B?3?+2+K''"!0! C$'+
! "# $%$ # " &'() * +!*&,-%.%#/// %# "0 12%20 3$% 4516-*&1 /278-(-()9+(,-&-::2.2%20# ;<;=>?@ABC>@=D>E>CFG ;<;=>?@H I JKLMNOPMQKRSTU VWJKLMNOPXONMXYKZ V[SOUXZLUOZX V]MKQZRKTSKKUQSÛ V_̀a[bcdefcghcijkclhehcmhmnockpqojmrmelsjrljtcujdrnjbcdefcghcbjdfcdvrmwjijmexhujdlhfhwrehcmyzojmrme{jcndrk|hwxhujdlhfhwrehcmijmexhujdlhfhwrehcmyz}erejsjrlj~redhehjlojmrmebdw|rljkehcmle|jdijrglerejmujlevjmelRSONOJSNTKUQSÛ a]̀tcmlcgh
rej
}erejvjmelcfkjdrehcmlijwcmwhghrehcmcfoxrm
xtcmlcgh
rej
rgrmwj}|jjeljzxjye~jedhwlxjye}vvrdzheztrkhergodrmlrwehcmle|jdhmrmwhrghn|ghn|elTKXXNQP Ẁ[
!"#$%&'(#)*+,-).!"#/--+(#)012!+2').!"#3-2'1-'(#)4567689:;<=9597>?@5AB=C=9:767ADE8F>=G>H@:65A7A675>79:5:7=CI79:B7C::689:7CJ5J7A=C:K7LMC769K=ED5GN8=9=:=LCDA7I7>LEB7C:5CA>759=CJL?97C=L69KL89=CJ5CAK75>:KG567@67>5:7AE6LE76:=79O4567689:;<J7C765:7967I7C879E6=B56=>HFH>759=CJE6LE76:=79:L5A=I7697J6L8EL?>LG5>D67J=LC5>5CAC5:=LC5>97C=L69KL89=CJLE765:L69DK75>:KG567976I=G79E6LI=A769D5CAL:K76K75>:KG567@67>5:7AF89=C79979OP=CG7=:9A7F8:5959:5CA5>LC7E8F>=GGLBE5CHLCQ8C7RDSTRUD5CA59L?P7E:7BF76VTDSTSVD4567689:;<K597WE5CA7A=:9:7C5C:6L9:76:LSVLE765:L69D5CAK59J6LMC=:9675>79:5:7EL6:?L>=L:LSTXC7:@>7597AK75>:KG567E6LE76:=795G6L99SY9:5:79DGLC9=9:=CJL? SSDYVV LE765:=CJ F7A9Z8C=:9D7WG>8A=CJRYE6LE76:=79G>599=?=7A59K7>A?L695>759L?P7E:7BF76VTDSTSVD:ML?5G=>=:=79MK=GK567=C:K7E6LG799L?F7=CJ67E86EL97A5CA:ML:K5:567CLC@LE765:=LC5>O9L?P7E:7BF76VTDSTSVD4567689:;<5>9LK5A97I7C97G867A>L5C967G7=I5F>75CALC7B7[[5C=C7>L5C67G7=I5F>7O ];̂ ]_̂<;4];P-̀-.!")a--(+2b-c-)d+&1e!)-,+12 fg<hihP4]j;k*).,2lb+mnopqrstut.tvqw*x(!c'+x)'2.0&--e)nouqpsyzv.zwtz0#)2.0b2'-nopqpstty.yttq{m*-!c'+x)'2.a&2'-,&)2"1'no|qtsury.puq}m1b-012.0b-'"-~&"2notptsvrt.pzuy}*!!c'+x)'2.x"+!)b+nozzwstqv.prz|'#+.'x-)nopqpsptq.utqr,+2/)b.!b--b))2mnorzrs|z|.|wut kK=9=C?L6B5:=LC=9E6LI=A7A59L?LI7BF76DSTSVOK=9>=9:B5HF7=CGLBE>7:75CA=998F7G::LGK5CJ759?=6B9=C=:=5:7L6A=9GLC:=C87GLI765J7L?4567689:O>7597CL:7:K5:5CHLE=C=LC9D79:=B5:79DL6?L67G59:967J56A=CJL86K=9:L6=G5>L6E67A=G:7AE76?L6B5CG7B5A7FH:K7975C5>H9:9567:K7=695>LC75CAALCL:67E6797C:LE=C=LC9D79:=B5:79DL6?L67G59:9L?4567689:L6L86B5C5J7B7C:O4567689:AL79CL:FHL8667?767CG7L6A=9:6=F8:=LCL?:K7=C?L6B5:=LC5FLI7=BE>HL867CAL697B7C:L?L6GLCG867CG7M=:K5CHLE=C=LC9D79:=B5:79DL6?L67G59:9L?:K7975C5>H9:9O<C:7679:7AE769LC9B5HLF:5=CGLE=79L?5C5>H9:967EL6:9LC:K7=6LMC59M7ALCL:A=9:6=F8:7:K79767EL6:9OP7I765>L?:K797?=6B9B5HD?6LB:=B7:L:=B7DLMCL869:LG5CAZL6KL>AL:K76>LCJL69KL6:EL9=:=LC9=CL869:LG5CAB5HE6LI=A7GLBE7C95:7A976I=G79:L89O
!"#$%#%"&'()*+,-./0,123456786'85922:;<-.2345=7>?@4=A755'B<0:2C(<D345EF?FBG=H'I-C20D0,+2J<)K2345EL?FB'MKC+C<-N,-.OP<02+3=567AA>BG=H QRRSTU'(*0D*0<C2;<C,-.3VVW+C<X)2Y'O2-,*0Z-+21K02N[*C2+3VV '(*0D*0<C2;<C,-.3VVW+C<X)2Y'O2-,*0Z-+21K02N[*C2+3VV],C1PÔ/'(*0D*0<C2;<C,-.3V<5W+C<X)2Y'O2-,*0Z-+21K02N[*C2+3V<5B**N_̀+ ab cdee f ghijkj gg eddkj lmn gdkjk geoUpbqrsRUrtrutQUUuvRSTwUtvSoxUwUxovwxoyQzuR{UtUruSt{ouUSQRSTuSQwovsS{|U}w}v~zuR{soTvkuUSQRSTUwUsUSQUUuvRSTwUtvSoxwUxoyQzuR{UtUuSQwsoTvojoxotRovouSUsUSQoUoxsvdh ghgdSQrtuQouUSUruQtoSUrRtSQoSvSRStoSrRtQQRRoSt{ vouSUrtuQbesosRUrtUURxRQUwtQxoUtUoxsvdh ghgd yoxrRtRRUywRrwRSwsorUUoxRSTsusoUQSQyowSoS}osRoStlStootUv{SoQQQuoouSQRST
68
! " #"$ % !& ' ( )* !+ # , - . . ,, ! #% !/ 0 # % - !12 .% . . ,, !3"4 ! !5" ! !6" ! !7"8 9 : . 3))&;&+ 3)+;)&;&+. % <3!6 =5!1>?<5!3 =6!/> ? <6!7 =7!6> ?!;@<&1!1 <&3! A=BCDB? 4EF!"4EF - ( 1 7!5> " #". </&;.;;; 1 &!@<+/!& <+1! CD 4EF !" " #" 1!6>!" &;&5 ;> " ! <& =1!6> ?! GHIJKLMJHLKNOPQRSKTHLUPVKRHOKW XY Z[] _̂]̀[à b̀a_]̀cdc_] eaf[gah i[fgjgg]k lhgg[jlhm]kn]hopq lhgg[j_̂]̀[ghrs]tkuvhgkowq lhgg[jx]hoyq lhgg[jzg]jto{q|upuw}p{ d~]hkgrh̀a_ ei
i[n_k [̀gak { }p|y p}}y |}}}
uw}p{lhm]kn]hk | yy|} p y}| ww}plhm]kn]hk w} wyy}w p{} www|y |w}p|lhm]kn]hk y w}wy w}} w|}{ pw}plhm]kn]hk y| y}} yyw{ w}}} }w}plhm]kn]hk pw pp} pp}y w}plhm]kn]hk w y{}{ yy{ y}p| w}w}lhm]kn]hk p p}w| |p y w}wplhm]kn]hk p} p|| pw{ pyp}y w}wwlhm]kn]hk w p|p|y yyp pwpy }{u}puw}wy an]hnnng
i d w p}} w} p|y o|qu}puw}wy ~[_]̀kegmghr ei le w ppy py| pp} { oqu}puw}wy j]m[gah̀a_
i p pw}w p{ pp{} {|u}puw}wy m]̀̀]]h][j~̀a_
i d p p{yy} pw py| oq|u}puw}wy xgtr]jgh][h[r]n]h ei l̂ w wppy p} p {|u}puw}wy eghk][j~f[̀]̀a_
i
i[n_k y p{yp y }p oq|uwuw}wy ]f̀]tea[h
i[n_klei y wy wwy wyy }|uy}uw}wy eghk][j~f[̀]̀a_
i p pww ppw { oqupuw}wy ]f̀]tea[h
i ie w pw p p{p }u}puw}wy s[ck~g̀]
i p w|pw p w|y p}pop}quwuw}wy ]f̀]tea[h
i y y|{ y| {w pw}p}uwuw}wy am]h[h[̀]
i w yp{ p {}w popqw}wylhm]kn]hk wy w| wy w{w} m]̀[r][hh[jghm]kn]hkw}pw}wy wy ww|} p} w}p
! "#$%%& '( #! ''# %' %)*#+ $, +! ! +# -./01.23.456.7303.8389:;.2</7380=.>7<8;7?:@7.1A.B5CD5/EFGHGI? HJ KLMNOPLQRNSOTOMOLUVWXL YZ[]ZXL]MOLU ]ZXL]MWVWXL YZ[̂LQU _LN]̀aZPM]NSMbNTKLPM cUMOdNMLQKLPMaZddLPSLdLPMKLeVLPNPM f ghR ij k lffmfnòpKLeVLPNPMqaZPrL]UOZP f ghR fmm s̀tùofp fPQvNT[fmfuu fij w s̀tùxPMvLyN]zLM{MNMbU YZ[]ZXL]MOLU ]ZXL]MWVWXL YZ[̂LQU fmf|aZTLSMLQKLPMo|p cUMOdNMLQ}LM]ZSLLQU~PQL]hx ̀ ghR m̀ w k w |s|̀myN]zLMOP ̀ {}R tf̀ s̀tfi V̂yN]zLMOP ̀ ghR u k V̂yN]zLMOP ̀ {}R nn |̀| V̂ù inm w s̀jf w |s|̀m
!! """# ##"""#""$"%&"""""#""" !!%! '()&*+, "'()&*+,- """"".""%/""""."" """"""".% """"""""""""" "#"""% '"""0"""""".""".1%%*"2"2"342245" +,'+""""# 67)*$ 8"3422,9"45%: ""22,9""000""" ".%/ "'.,""& ;" !""""% """<"#"22,9""" !! ". ";"22,9".."#"22,9"#""#22="""22,9"# :""#;.">" !!!%&"35""22,9""#"22 "35""22,9"#"%'000"%/ "'.,""& ;" !"""%? """#@"6!!%A """&0"""B"-!!%C $;%8 ""@"-"+!! %DEEFGHIJJKLMFNILKOOPQPIRKHPRNILSKQPIRT UVWXYUZ[[]̂_ẐZ̀VaZbcZdXe Yf ghijkilmnopqrnsisltuvpwxyz{z{ ghijkilmnopqrnsis|}niw{yz{zw ghijkilmnopqrnsis|}niw{yz{zw~uix
rvj}siqqim}nsq nvj}siqmuois}nsqrgmkiutiz rglmkiutiz rgmkiutiz rglmkiutiz rgmkiutiz rglmkiutizxgpirnqnum}w w{z w
wz xz wz xzz~umuoltntiinoum} x{ xx xw x xx xxwtqvtstitjopvtui xx z{ x zxz x zxzmkintnotui z{w z xw zxz xw zxz~umksinvium} x{ x zx wzx zx wxzrs}umitjopvtuiy xx x {
x
{
x
gpi~inntnoum}w xz x {{ {
{ {{ {
{nqitjopvtui
tqpuiinmum}noiq
xwz x{ x{ x
x{ x
x{¡ltntiino zx z
zx z zx zgmotjgmx{gintnoq zx zx zz z zz zjopiugintnoq x{x xw
xw{ xz xw xgmotj z{ zx zx z zx z
!"!"!#$%!&##'(()"*+#,"%+#!"!-,.&/.,!+0%1 !"!"!#$%!&##""%+##"*!"!)!2!%3-24"%!#("!#&!##&#%&# !#"5"&%!(!!"!&%#,&"!#(!,163!"!7"+!6869#!#%#(!:%;&88<(! !#&&:&5#%&,!%&#:&("# *!+ !!##$%: ""#+1=&&*: 5,'&&!!!%#%!&%+$%7"+!98:6869+%"!!%! ,& !(!"#"!&:(!&&#!#%#(!%&19)%!>&!"!3&&&+*1?=%5#%&%!#%!&!#+&;;!#+ 7"+!98:68691=&&*:%5#%&@"!"!# &(& ! 7"+!98:6869:' #'(#(!("!# +,!"%!"&&'(!A"!1@3!"!B%6869#!#%#(!:%;&:&5#%&,!%&#:&("# *!+ !!##$%: ""#+1=&&*: '!&:&&!!!%#%!&%+$%B%98:6869+%"!!%! ,& !(!"#"!&:(!&&#!#%#(!%&1C=%5#%&%! #%!&!#+&;;!#+ B%98:68691=&&*:%5#%&@"!"!# &(& ! B%98:6869:' #'(#(!("!# +,!"%!"&&'(!A"!1D3!"!7"+!6866#!#%#(!:%;&:&5#%&,!%=&&*: '!&:&&!!!%#%!&%+$%7"+!98:6866+%"!!%! ,& !(!"#"!&:(!&&#!#%#(!%&1E=%5#%&%!(!#%!&!#+&';;!#+ 7"+!98:68661=&&*:%5#%&F"!"!# &(& ! 7"+!98:6866&' #'(#(!!'!("!# +,!"%!"&&'(!A"! %#(&1GHHIJKLMMNOPQRLONSSTUTLVNKTVRLOWNUTLVX YZ[]̂_̀abc[d_]aZ_e f_[ghijbiklîmnopnpmf_ibqrji s]t̀̀b̀i_ ujî]b̀avwiZ_xyàb_ za{i_bkiab|}~ [gq[b]za{i_bkiab iab|p~ [gq[b]iab d̂iab̀iZ|m~h̀iZd̂_̀av }
}o
n }ommop }n }
o p }ndb̀hî{̀ti]kjd_ p momp mom} pn} m
o }
hià[̂_[d_̀av mp po
}po
}om }mq[b]ibi]_iZf_ib_|
~ pn ppomm }omo
}nnn }on }nnn }nmf_[gdaimnopnpmf_ibqrji s]t̀̀b̀i_ ujî]b̀avwiZ_xyàb_ za{i_bkiab|}~ [gq[b]za{i_bkiab iab|~ [gq[b]iab d̂iab̀iZ|m~h̀iZd̂_̀av }
}opnm }omommn n }
pop} p
}ndb̀hî{̀ti]kjd_ p momp mop pnm m
o } hià[̂_[d_̀av mp po
}po
n n }op }nn }mq[b]ibi]_iZf_ib_|~ pn ppom} }o}op }nnn }omp }nnn }npf_[ghijbiklîmnopnppf_ibqrji s]t̀̀b̀i_ ujî]b̀avwiZ_xyàb_ za{i_bkiab|}~ [gq[b]za{i_bkiab iab|~ [gq[b]iab d̂iab̀iZ|m~h̀iZd̂_̀av }
}o}m }opom
p }momm }n
db̀hî{̀ti]kjd_ p
mo
mmomn pn m}omm } hià[̂_[d_̀av pn }o
op} } }po}
}mq[b]ibi]_iZf_ib_|~ } p}on }opop }nnn }omn }nnn }np
!"#$!%!&'"$!&%"&$(')"%" **"(""&$(')+%%((",- !"#$!%./&/&($(0(%1%0&02/ )&34-5453-60$(((61($1&("1/&$0)("7&/!&/%"%61&""8/&("+59"&/&"2/ )&5453$"&$!$1&"-""!(*%44:1&0&$"(%%"((-"%#$!%7&!"%("$ "%1( /$0",&") "0&&$"$;!((("-(0//($)+%%((",-(06"&%("- "%%&&&!$!&%!);!"2/ )&34-5453-1("((& "%%$"&$!$1&"(!%+ <=>?@ABCDEF>GB@D=BH IB>JKLMELNOLAPQRSQSPTUVW@XC?CECLB YMLA@ECDZ[L=B]DCEB L̂DETSV _>J̀>E@?̂LDEÙFLaDBCZDbA>GM cd UQRPcc e fgRgSP PhiQ_SjAC>ACEkl@D@ZLNLDEbA>GM Um SRUhh PQRShP UmiS_Pn@BX@=C@oL@?EFX@AL US URQmP USRgfm fih_hjA>pC=LDXLbA>GM g cdc UQRgdQ mih_ma=GA>oL@?EFX@ALRqn c URQQm cRmch hid_>̀E@?̀>Mm̀LD@DEB UhU UmRmcQ e UPURUQm fmic_fn>pLD@DEn@AL g cPm dRdU hih_g̀FLjLDD@DEbA>GM UQ URQQS dRUQQ hiU_dqCDrBoL@?EFX@ALbA>GM h hdf fRdQP Pih_c[@kBFCALKLDC>An>NNGDCECLB m mcf fRfgc Pih_UQsqnl@D@ZLNLDE c cUg fRhch PiP_>̀E@?̀>MUQ̀LD@DEB Ugf UcRmSf e UfgRccS dhih_I?YEFLÀLD@DEB PQ PRQQg e PURUQP Umif_>̀E@? SQf SSRmPP e UccRQcm UQQiQ_
!"#$%#&'())$*+,'()-./0.0-1234&1$&)53&)14$)365(41$'7764$)365(4"81166$49/'$&234&1 :,)$,)6346*6141*$)4$*+,'()-./0.0-/;$*36466;63)6,)$3$*(6<),&),$11;$)$=$,)6$4" >! -.! 00! ?! @! >! A!A! -! 0! 0! ! ! ! ! ! ! ! ! !
!"#$!%!&'"$!&%"&$(')"%" **"(""&$(')+%%((",- !"#$!%./&/&($(0(%1%0&02/ )&34-5453-60$(((61($1&("1/&$0)("7&/!&/%"%61&""8/&("+59"&/&"2/ )&5453$"&$!$1&"-""!(*%44:1&0&$"(%%"((-"%#$!%7&!"%("$ "%1( /$0",&") "0&&$"$;!((("-(0//($)+%%((",-(06"&%("- "%%&&&!$!&%!);!"2/ )&34-5453-1("((& "%%$"&$!$1&"(!%+ <=>?@ABCDEF>GB@D=BH IB>JKLMELNOLAPQRSQSPTUVWLEXYL@BL=IBLEBOZKE@EL [@C?CECLB ]MLA@ECD̂_L=B̀aDCEB bLDETSV c>Jd>E@?bLDEUe@?CJ>ADC@ ff gRfgh i gjRkQk PQlQcSdLm@B fg gRhkf ffRUhP SSlScPY>GCBC@D@ h URUnf UkRhfQ jlQcfo=@F> Uk URfkf UgRUQS klncgIACp>D@ U URPfQ UPRfSj nlkcd>MgKE@ELB USg UgRPUQ i UgQRSnU kglgcko?CD>CB U URQgP hRSQf flUcnaE@F UP URPkf kRhgh Pljche>?>A@=> k khg gRjjU PlQcjq@BFCD̂E>D UQ jPn fRjfP SlgcUQ]FC> n nSP fRPjk SlScd>MUQKE@ELB UkS SQRQhU i UhURngf jUlScI?]EFLAKE@ELB Pf SRfgS i UkRffU hlhcd>E@? SQn SSRgPP i UjjRQjg UQQlQc
! "##!! "$!!%&'((!!)!*))+(",-&.-.,&/)!!!/*!*!*()"!0((/*1(!$.23!%4(**(!!%)*(!%)*!!(!(*(!&!)%$,5(+(".-.,*&!#--6*)!!!&0!*!()%")7!!!&!)((!"$!!%&!)/!&"7+(",-&.-.,&*!!!*!$89)!!%&!!0!#):.$;!!&!%*1!0%(( !"!&/*!*!'%/!&!!!*"" $ 23!%46)<5 =>?@ABCDEFG?HCAE>CI JC?KLMNFMOPMBQRSTRTQUVWXMACMYAFHBDFZ[MABUTW MEFUQW ]?K̂?FA@MEFTRT_ ̀ VSabQ Rcb]TRTd aS_de Tcb]TRTf fSQQR _cd]TRQR eS_V QcT]TRQV aRSTaT TacT]TRQT VbSRTd fcV]TRQQ TRSQ_d VRcT]TRQ_ QQSbbe VdcR]TRQe V_STRf dcV]TRQb QfSadaU_W Vfcf]?̂FA@ ̀ VffSRfe VRRcR] g6 -$h6 g6 g6 .$h6 g6 8$i6 ,$.6.'$.6j$6-$.6i$-6 g6 i$6 g6 j$j6.-., .-.8 .-.' .-.; .-.i .-.h .-.j .-,- .-, .-,. .-,, .-,8 .-,' .-,; .-,i .-,h
!"# $%"#&''"'( &!&')*+#$,&$#$'&')-./0,"$'.1'"'& $'2'&)&(%#&'.-1%34#"'2%"'$&5!'&,$&,$%#&'#$&!%""$ $'2#'.67#&'2#&' !89+&!("#$&.:9+&!"#&"&;"&'$"'"$5' .<='$#$'*#4($->-6'$" ""%$'?"'' "&;!">>0%"$,$'&!"!'&&?"'! !)$ '!"&'4"'!%&4#","'2$'"("4',$$'"@ &&&'?&,"##&"(.8!!&&'"2?&,""A"'$!&'?"4'!!$$$ $! (@ '*#4($6>?->-6?%&'&&"$"4'!!'$" ""%$'& !./7#&'A&'!A&'2#',$&4'%,$4%#&'#$&!#'!".B7#&'A&'!A&#' '&%#&$"&',%"$4.CD $%"#&'$,A#&'2#.EF' !'#$#$2"&,&!"%!,$"",*#4($6>?->-6. GHIJKLMNOPQIRMKOHMS TMIUVWXPWYZWL[]̂̂[_̀aTMWPbcXW dLIXWLPNWM eWKMWfgXNLKPNIO hXPNIOdWLNIHhXWOiKPW_̂a hXPNIObcXW_[a jRLWOPjKMQkWOP_la mIUbIPKJkWOP_laVno ` pKLqQ̂̂r ls̀ŝ̂̂ _ta Tsu_va w[̂ xlmVnosjKYXRM ^ hqPIZWL̂[̂ s̀̀ŝ̂l _ya T ]̀rv_wa xy[mVno l nIzWYZWL̂[l `̂s̀ŝ̂l _ta T []wr̀ ̀xwrm̂xŵm
!"#$%&'() '*'+,-./01$23-2456&($$7--2,-./010"#332-0 "$-"-0"0"7-8'&*/2/"%%2&9-/"%%2$ "3!1-456&9-/"%%2-:1";03/1!0"037-2!"-/ "13& <=>?@ABCDEF>GB@D=BH IB>JKLMELNOLAPQRSQSPT>AEU@ULV>@DBWDXLBENLDE Y@ZC?CECLB [A>MLAE]ML V>Z@EC>D M̂LA@ECDU_L=B̀aDCEB WDXLBENLDE b>DEA@ZEG@?WDELALBEc@EL T@EGACEd@ELKLDC>AN>AEU@UL?>@D ef KgỲb@NMGB TC=hIE?@DECZ eRijk l imRQQQ fnopqer k̀PQ̀SQSiT>AEU@UL?>@D P KgYb@NMGB̀WVY bI SSP SmRjjP jnQp k̀Sj̀SQPPT>AEU@UL?>@D o KgY sI kjQ SoRjQQ jnQpqer j̀f̀SQSmT>AEU@UL?>@D m KgY bI kQQ SSRSmQ eQnipqer f̀èSQSmT>AEU@UL?>@D S KgY YV em emRiSi jnQp f̀èSQSfT>AEU@UL?>@D P KgY bI Pjk PRmko eSnQp j̀Sj̀SQSkT>AEU@UL?>@DqSr e IVY Wg ekS SRQQQ jnQp m̀PèSQSo]>E@?T>AEU@ULV>@DB Pk PRjfS l ekjRoPo jnQpTLt@DCDLV>@DBWDXLBENLDE Y@ZC?CECLB [A>MLAE]ML V>Z@EC>D M̂LA@ECDU_L=B̀aDCEB WDXLBENLDE b>DEA@ZEG@?WDELALBEc@EL T@EGACEd@ELTLt@DCDL?>@D ef KgỲb@NMGB TC=hIE?@DECZ g̀I l SmRQQQ enQp k̀PQ̀SQPS]>E@?TLt@DCDLV>@DB ef l SmRQQQ
!" ## $$ % &$ '$ () * # + $,- &$ . () * # + $,-/-/, /-// /-/, /-//0121341567 8" 9 :;/;< 9 =>-;< 9 ;=:;/? 9 ;,@<,;A $ $" =?:@ ,/>: ;/@;- ==@;'8$ B ::<> :-/@, ;:<-,? ;==,//CDE135156F #$ "$G ;,-,= ;//:? ,>@<< ,<,@-A $ !# ;>:- <,:: ,/?;> /-=--H$# $I! /;?> ?@; ==,> ,,?:A#$ J$ 8 B </,/ ;/,// ,;:;- >,>-?H$BJ$88 K K K ,<==H$# $I# $L !# ;/,@ ,<-< /<?- =,==M $8$B ::;@ :;:@ ;:/@< ;:,:/'8 !# =;@=; =/:@; ;/=>;- ;:@=-;NOP1QRST5UV3WTX16Y%L8 J$ 8 K //<>% ;@:< /;-;%Z$ 8G 8 $$ 8 $ 8 B :/:;% =>-?% ><:?% =>-?%'8 $8 :/:;% ?@@,% :<@<% ?<->%[1OV3WTX1RST5U <?<: >-@ />=/< /;<<?%. 8$++8 "$8L $ ;% K ;% K. " 8%$++8 $ '$7)A'A"] 9 <?@? 9 >-@ 9 />=,@ 9 /;<<?%ĈQ3V3_5RST5Û2̂VŜ̀S1OTWTXXT35OTWaPTSb1Q5E1QWTXXT35P̂Q16c" 9 -]-< 9 -]-; 9 -]/> 9 -]/,%F8 9 -]-< 9 -]-; 9 -]/> 9 -]/,%d1V_PO1bê21Q̂_134X̀1QTfWTXXT35P̂Q156c" ;-=-; @??-: ;-->=< @?:/>F8 ;-=,; @??/: ;--@;< @?:/>gV2Vb13b5b1WŜQ1bE1QWTXXT35P̂Q1 9 -]/< 9 -]/>: 9 -]<= 9 -]</:
!"#$$%&$"! '( )*+,-./01./2,-0*.304 56789:8;<=:=>:?9:@A:8BCDECEE 56789:8;<=:=F:G:@A:8BHDECEE 56789:8;<=:=I78GJBHDECEB K-*L/MLN.3M3O-.MPQRSQSP K-*L/MLN.3M3TMU/M+VMLPQRSQSPW:9X<GY@:Z[Y]798XA697A[:9Ŷ78:_869̀;a_Da<Gb c dQec fgRPhQ c feRSSd c )ghg4c hRieijMULMk1*/1,.*.3*+,L/1l*/1,. fSRSmi fReSi fSRSPh fSRdfi fPRQPgn./MLM0/MoUM.0M hRPmm eRiQh eRhSd fRQgQ fRdmQp+,L/1l*/1,.,q0/,krsV*0M3k,+UM.0*/1,. fRPhQ fRgiP ePi eSg fRmfe;ta_Fu798XA697A[:9Ŷ78:_869̀;a_Da<Gb SSRdQQ PdRPd gSRSSh SgRfei PgReeen+U*1L+M./,qLM*vM0/*/M1.wM0/+M./0 fSRPSS mRPmi fRhhi SfRPeS hRSPSxL,w101,.q,L3,-V/q-v*k,-./0*.3vM*0MLM0/L-k/-L1.y z PeQ z z zxL,UML/{,UML*/1.yMoUM.0M0 PRhSf efg fRfPg hPf fRgfi|,0)y*1.4,.0*vM,qLM*vM0/*/M SRShd fRiih dQ )SRQSh4 z}.LM*v1lM3v,0M0,.,/2MLLM*vM0/*/MLMv*/M31.wM0/+M./0R.M/ gRdQi SRPei gmg SRfmf mRSmfWY8@7[X~:=;ta_Fu798XA697A[:9Ŷ78:_869̀;a_Da<Gb c gmRhPic ghRfQf c gmRdS c giRmgS c geRhehW:9X<GY@:Z[Y]798XA697A[:9Ŷ78:_869̀;a_Da<Gb c dQec fgRPhQ c feRSSd c )ghg4c hRieiM*vM0/*/MLMv*/M33MULMk1*/1,.*.3*+,L/1l*/1,. fSRSmf fReSf fSRSPP fSRdfS fPRQShn+U*1L+M./,qLM*vM0/*/M1.wM0/+M./0 fSRPSS mRPmi fRhhi SfRPeS hRSPS|,0)y*1.4,.0*vM,qLM*vM0/*/M SRShd fRiih dQ )SRQSh4 z6<=8Y@?:879XY<Z]798XA697A[:9Ŷ78:_869̀;a_Da<Gb SdRmie PPRPSm PPRgfi PfRmeS SeRemixL,w101,.q,L3,-V/q-v*k,-./0*.3vM*0MLM0/L-k/-L1.y z PeQ z z zxL,UML/{,UML*/1.yMoUM.0M0 PRhSf efg fRfPg hPf fRgfi}.LM*v1lM3v,0M0,.,/2MLLM*vM0/*/MLMv*/M31.wM0/+M./0R.M/ gRdQi SRPei gmg SRfmf mRSmfWY8@7[X~:=798XA697A[:9Ŷ78:_869̀;a_Da<Gb c PiRQeic PdRQSm c PmRQQg c PgRmdg c PiRiSP
!"##$%&'"%$(()*)"+$!)+'"%,$*)"+ -./01/2324520106789:;<=>>?41@><;A/01521B.@C DE FGHIJKLMNKLOIJMGKPMQRSTRULURVMOGVRPGLGW XJGVLRVYKPRPZRULRH[RV]Q̂]̂̂ XJGVLRVYKPRP_RTRH[RV̀Q̂]̂̂ XJGVLRVYKPRPaGVTÒQ̂]̂ XJGVLRVYKPRPbJKR]Q̂]̂ XJGVLRVYKPRPZRULRH[RV]Q̂]̂cdefghijdklimnoepfqreoqldeisopdtprmeuvwtxwghy z {]|z }̀Q~] z |̀Q̂̂{ z F}~}Wz ~Q|RGRMLGLRVRGLRPPRUVRTNGLNIKGKPGHIVLNGLNIK `̂Q̂̀ Q̀|̂̀ `̂Q̂ `̂Q{̀̂ ̀Q]̂~HIVLNGLNIKI
PR
RVRP
NKGKTNK
RRM ̂] ]| ]~ ]|HIVLNGLNIKI
MLIT[GMRPTIHURKMGLNIK Q̀~] Q̀} | |̂} Q̀̀|ZLVGNOLNKRVRKLGNKTIHR FW FW { { {HUGNVHRKLI
VRGRMLGLRNKRMLHRKLM `̂Q̂̂ Q Q̀~~ ^̀Q|̂ ~Q̂̂IMFGNKWIKMGRI
VRGRMLGLR Q̂̂~{ Q̀~ {] F̂Q]̂~W rgmofloqldipfmepfqrefigknoepfqreoqldeisopdtprmeuvwtxwghy |̂Q} Q̂] }Q|~ Q̀̀ ̂Q]|̀VINMNIK
IVPIJ[L
JGTIJKLMGKPRGMRVRMLVJTLJVNK |] VIURVLIURVGLNKRSURKMRM Q~̂̀ |̀} Q̀̀} ~̀ Q̀}̀KVRGNRPIMRMIKILORVVRGRMLGLRVRGLRPNKRMLHRKLMQKRL }Q{] Q̂| }} Q̂̀̀ Q̂̀cipjolfdoepfqreoqldeisopdtprmeuvwtxwghy z {Q||z |Q]̂] z Q z Q̀ z ~Q{~oepfqreoqldeisopdtprmeuvwtxwghyxdpmopd z ]̂~z ]} z ]} z ]̂ z ]̂|cipjolfdoepfqreoqldeisopdtprmeuvwtxwghyxdpmopd z ]{z ]~ z ] z ] z ]oepfqreoqldeisopdtprmeuvwtxwghyxdpmopd z ]]z ] z ] z ] z ]̀cipjolfdoepfqreoqldeisopdtprmeuvwtxwghyxdpmopd z ]|z ]}] z ]{ z ] z ]{flreddfedodpodmopdmiremeogfg |Q{̂ |{Q}]~ ||Q̀| ||Q] ]̀}Q}̂̂
!"#$%&$&# '(!"#)%&$&&*+,-+./01% 2 )%3#4%$562 )%5&)%5)$7""0"01%8"10 )6)%)93 )34%#46:08"0% &)%#5) )&%&;)<(=10 #%563 )#%)96:(""(1!0 #6# 5)4>" ? "% &$%465 )%4;$'8"8(@(% 5%556 3%5&6AB-CDC+,-+ 2 )%949%3452 )%4&$%96)EFCGFDF-F,+CHIJKLF-M."(" N!0% 2 #;3%6)42 #;3%)3$"(""0% );;%3$9 );;%#56O(""101@("8(0N P )&3%$$$:( N!0%("0!08""0!0 &6%635 &5%#4$'1 N!0 #&%5$# &9%33$AB-CDDFCGFDF-F,+ 434%36$ 9)%5$6JKLF-M.<(Q )%)35 ;;$:0 R( 0 )%344%)4) )%&53%##9<01"!?(8"@ 539%#;# #;4%;35AB-CD+-BSTUBDI,V+W,KLF-M )%)$;%;&& 65;%#9#XBHYSBH-VBDFHZFH-,V,+-+ )%$4& PAB-CD,KLF-M )%)$%;65 65;%#9#AB-CDDFCGFDF-F,+CHI,KLF-M 2 )%949%3452 )%4&$%96)
! ! " # $ ! !% & ' ! " $ ( ) * $ $ !% + ,- . / 0 # " 1#%% 2 3 %4 5 ! ( 6 5 !% 7 ' ! " $ ( ) * $ $ ! $ " %899 :;<=>>?@AB C=@ ?DDEFE=G?< EGC=@H?FE=GI 5 4 JKL MKNO PKOQRST UV 7%W 7%W 7%W 7%W 7%X Y%7 Y%4 7%W 7%Z 7%Z 4%[71714 ]1714 X1714 41714 717144 ]17144 X17144 417144 717147 ]17147 X17147 44%̂ 44%̂ 4[%̂ 47%̂ 4]%]̂ 7%4̂ 7%]̂ 4W%Ẑ 4]%4̂ 4]%4̂ ]%Ẑ71714 ]1714 X1714 41714 717144 ]17144 X17144 417144 717147 ]17147 X17147 7 7
! " # $%&' ()'*+,'- ./0%1*2% $%&' .*33)+- 45 6 6 6 78 6 798: 9 ; < =$%&' ()'*+,'- >%)+?+,@/,A)2 BCDEFGH IJ KLDMHFJCHN OPQKPRSPG TUV WUWTXPSK YJKPGPHK ZFKP [FKMGIK XFKP ]GIĴIQFE _ D̀ ]GIĴIQFE XP̀PGPC aDFJ bDHKH cPK bFGIJd eFEMPfghij klmi niomOPJIDG MJHP̂MGPC JDKPH QFFSEP Tpqrs _ WUWq t uUUVUUU vvpr _ t BuVwquN t TxsVqwv fyzlmg{| klmi niomOPJIDG MJHP̂MGPC KPGR EDFJ vpxWs _}w~ WUWv WUUVUUU TTpT _ BuxTN wxxVsUr DKFE XPSK upqxW _ t vUUVUUU wUUpU _ t BuVvrN t sxsVTWT
! "#$ #"$ % & '(& ) *+,-# ! ) &. / ! "#$ #"$ % 0) ) ) &. / +, % 1 2 ) *### $ ! ) 3 & % 3 ) ) ! ) 45 ' 5 . 2 5 6789:; <=>9:=? @A=BC=D:9EBC FF GHIJ GHIK GHILMI MG MN MO PQRSTUVWXYZ Q[ ]SZŶ _HHĤ̀ IKaNNH b LacJ b KaNGJ IKaIHH KaKOI dVXTef g[YZehi dZefY jYZ ]SZY k IHlJH k b k IlNJ k b k INlNJ k IGlIO mInk GNlNJ oZQ̂ dZQfYYp̂ _HHĤ̀ k IcIaOKJ k b k IHaLOK k b k qOaONL k ILJaNqJ k IJJaHcN GHIK GHIc GHIq GHIL GHGH GHGI GHGG GHGNmGnMI MG MN PQRSTUVWXYZ Q[ ]SZŶ _HHĤ̀ LGO IHaJcO IHaGKJ GaOJL b LLH GaOHJ b b IKaGqJ IKaGqJ rsYZSiY dZefY jYZ ]SZY k IJlNI k IKlON k IclcK k ILlOq k b k GNlcO k GHlHH k b k b k ILlqL k ILlqL oZQ̂ dZQfYYp̂ _HHĤ̀ k IOaIOc k IcNacKH k IqGaNGI k OcaqLN k b k GNaJHJ k OqaIHH k b k b k NGNaqqK k NGNaqqK
! " # $ % & ' ( ) *! ! # +,, ! -.. /0122345 614 3778981:30 8:614;3981:< = > " # " " ? @ ABCDE FGHIHJGIK LGMCKGMCBN OP QR!"STQR!"STQR!"STQR!"STQR!"UTQR!"UTQR!"UTQR!"UTQR!"VRQR!"VRQR!"VRRW*W*" RS*WR*" RX*WR*" "*W*" RW*W*"" RS*WR*"" RX*WR*"" "*W*"" RW*W*"W RS*WR*"W RX*WR*"W UW!SY U!SY SX!UY SU!XY UZ!WY UZ!WY UZ!WY U"!ZY VR!RY VR!RY VR!RYRW*W*" RS*WR*" RX*WR*" "*W*" RW*W*"" RS*WR*"" RX*WR*"" "*W*"" RW*W*"W RS*WR*"W RX*WR*"WQR!WS QR!WU QR!WV QR!WX QR!WU QR!WU QR!WU QR!WV QR!WT QR!WT QR!WTRW*W*" RS*WR*" RX*WR*" "*W*" RW*W*"" RS*WR*"" RX*WR*"" "*W*"" RW*W*"W RS*WR*"W RX*WR*"W QWZ!QWT!V QWS!U QWU!W QWT!X QWT!S QWS!QWU!R QWT!R QWZ!S QWS!RW*W*" RS*WR*" RX*WR*" "*W*" RW*W*"" RS*WR*"" RX*WR*"" "*W*"" RW*W*"W RS*WR*"W RX*WR*"W
!"# $%&'#('()! *++$*!$$$,*$-$$,!$.!$(,!$*-*/*!$-.+$0"# $%&'#! !$*-$112 !"# $%&'#('*3..*,*-4+ *!$$$ *5.!6$$,%!&$'4$# $$0789:;<=>;?@@>< A B4*!,, *$*$ *5.C-,D!.*D E4$$-,."6%&E$ --.!.-4*$F!+$."2G'CHIJ K0D!.-4*$4*,4-5$4, -.$$,+!*$ $0C$! *, *$$-,L**F$1*!L*!6$$$B+MN1L6BOP(L*F$EQ $ND!*5OB5.KBB+!$MNBBBOP0#.&-!5%"*MR&%#"RP$, !5, *!)*,-!5$Q !ST-,Q !,*3+$M! *+!!Q !,*.!.-!)-$$P.!+!-!5$-5.-!5$0U VWX?A UV6!$K3$ $$-$('Y1$.!.,!$0'Y1$5-!5$$,!5$!,H*-$(-!3..3K.$(.$**4* !!4+$-$($3!$-K+,4.!$0#.5$,* , $.*(*+!5-$!/*5.$(5-!5*4* ! -!4.+,SS0#.$,!$,4 $$4$*$$ .$! *5(. $K-+(*+-$Z!-!$()$*3!$$-+$($-($!( ! !*!4$(*H$$ 50 ; VWX?A ;VY$*.!.,!$.-4*-$!$4$($ --*. $+,.$3.*.!-3.*!5!4+4$($ .$.+(+**$$+(5Q !**!0#.-+$*$4$5! *$-($!4$()$*,$$-+$( 5$.-$$(.5*,4$( 5) $$(!$*+$+*.4$$ +.5$*$0#.$,!$,-H!K !*+$3.-4$*$++,$+!$!+-$0"6Y1$5,.+.!4!$,-$!$$$,$*$Q +5$$ !,6!/.F$*$$.,$,*0Y4!$,-$!$$$$*-!!+ !$0=[U]; !"# $%&'#('0,$)-$()(*-*/*/,$KH$*-$07I9=[U];<,$)-$()(*-(/*$.(,--!5+$**/*+,MŜ ,,!5-+4 $P0=[U];<: W X 6+++&_'#C6%-* *5!,!$ *$!$M.+ -+P,.!+3!4H.-***̀ aT(8T8a*4**5.$-5!"# $%&'# *$ .$!$M.+ -+P,.$-*b-4**.,.$!$.$**.+.$* +$$ .-*(..+++&_'#C6%,$ .-*$*4**5. !/*.!5$ !5,0&_'#C6%,!$.--!,$**Ŝ +,0'**(35)! *,4+*$!$ $.$,!$3..MP!$$,*$D!*,E!(MP-!5E-!1 $1!5ME11P$ $(MP *++ $+,4$.$$!5$ !!* -5(M4P.4Q *,!5$,*3-$, **-H$!/*0=[U];<c&+$,$)-$()(*-(/($.(*$**/*+,MŜ ,,!5-+4 $P0=[U];<c: W X 6+++&_'#C6%L-* *5!,!$ *$!$M.+ -+P,.!+3!4H.-***̀ aT(8T8a*4**5.$-5!"# $%&'# *$ .$!$M.+ -+P,.$-*b-4**.,.$!$.$**.+.$* +$$ .-*(..+++&_'#C6%L,$ .-*$*4**5. !/*.!5$ !5,0'**(35)! *,4+*$!$ $.$,!$3..MP!$$,*$D!*,E!(MP-!5E-!1 $1!5ME11P$ $(MP *++$+,4$.$$!5$ !!* -5(M4P.4Q *,!5$,*3-$, **-H$!/*0= dA E.- !-!*5. , $*+$.$(! *+$$ *$.$$$ *,.6#L-+(-! $! $*+* $$.*$$ *-*$,.6#L-+(.$,$-,**0;WAeA ]e ;]112 !"# $%&'#('()! *+$+.H!!*f $$(/,*,*,+,$*$KH$*-$)-$0789 ghijklm no
!"#$%& "%'&(&)&)%*%)+,- ./0123456789:;% )%9%*689(8(<!%%=>)>? @%@!&&%(%>%%&(>%@!%(>%@!% !%%%&(%@%?!>%@?%@%%(%%@(>%>%?>%&=>(A%%(=&! (%B%%%@&%!%>!%%%%+CDE,- ./F54;:% )%9%*689(8(<!%%=>)>? @%@!&&%(>%@!%(>%@!% !%%%&(!!%%>? %>(%@%?!>%@?%@%%(%%@(A%%(=&! (%B%%%@>%>%?>%&=>+CGE,- ./FFHI% )%9%*689(8(<!%%=>)>? @%@!&&%(>%@!%(>%@!% !%%%&(!!%%>? %>(%@%?!>%@?%@%%(%%@(%%B!#A >(A%%(=&! (%B%%%@>%>%?>%&=>+CGE J- K-JL8;M(8M(%?%!%!+N/, JL- N/, JLFOP,FQRM%!>%@%%@(% @%&%!%>>%S%&%=@>%@ %>%&A%%>+9%>%&%>?(>(>(%>%%?(@%(T%>?+,-UCDE6789:;% )%9%*689(8$%B6789:;% )%9%*689(8%>%!T!%>%%! ?V;;W %%@%@&)>?XS?%>%&>%!%+6789:;% )%9%*689(8$%B6789:;% )%9%*689(8>%>% @!@ !!%%S%(&)>?X ?!>=>%%#>? +%%()>?X>!6789:;% )%9%*689(8$%B6789:;% )%9%*689(8? >% 6789:;$%B6789:;%>% ?%*689+CGE)%9%*689 @;:% )%9%*689(8(I% )%9%*689(8($%B;:% )%9%*689(8($%BI% )%9%*689(8Y%%>%A%Z%>%AV;;W>>%!>%&>%!%+7%&@!%%%S%%&A>%Y=>Z(&>%>@!%>% ?@%(@&%@@%?%%! T%#%+[%@%( ?=&@!&&%($%B;:% )%9%*689(8$%BI% )%9%*689(8!&!>%!>%&>%!% T>% T%>+'T@%(;:% )%9%*689(8(I% )%9%*689(8($%B;:% )%9%*689(8($%BI% )%9%*689(8Y%%>%A%Z%>%!T!%>%%% %%! ?V;;W %%@%@&)>?XS?%>%&>%!%+ ]̂_̀ab cd
v3.23.3
Cover Page
|
Nov. 09, 2023 |
Cover [Abstract] |
|
Document Type |
8-K
|
Document Period End Date |
Nov. 09, 2023
|
Entity Registrant Name |
CareTrust REIT, Inc.
|
Entity Central Index Key |
0001590717
|
Amendment Flag |
false
|
Entity Incorporation, State or Country Code |
MD
|
Entity File Number |
001-36181
|
Entity Tax Identification Number |
46-3999490
|
City Area Code |
949
|
Local Phone Number |
542-3130
|
Entity Address, Address Line One |
905 Calle Amanecer
|
Entity Address, Address Line Two |
Suite 300
|
Entity Address, City or Town |
San Clemente
|
Entity Address, State or Province |
CA
|
Entity Address, Postal Zip Code |
92673
|
Written Communications |
false
|
Soliciting Material |
false
|
Pre-commencement Tender Offer |
false
|
Pre-commencement Issuer Tender Offer |
false
|
Title of 12(b) Security |
Common Stock, par value $0.01 per share
|
Trading Symbol |
CTRE
|
Security Exchange Name |
NYSE
|
Entity Emerging Growth Company |
false
|
X |
- DefinitionBoolean flag that is true when the XBRL content amends previously-filed or accepted submission.
+ References
+ Details
Name: |
dei_AmendmentFlag |
Namespace Prefix: |
dei_ |
Data Type: |
xbrli:booleanItemType |
Balance Type: |
na |
Period Type: |
duration |
|
X |
- DefinitionFor the EDGAR submission types of Form 8-K: the date of the report, the date of the earliest event reported; for the EDGAR submission types of Form N-1A: the filing date; for all other submission types: the end of the reporting or transition period. The format of the date is YYYY-MM-DD.
+ References
+ Details
Name: |
dei_DocumentPeriodEndDate |
Namespace Prefix: |
dei_ |
Data Type: |
xbrli:dateItemType |
Balance Type: |
na |
Period Type: |
duration |
|
X |
- DefinitionThe type of document being provided (such as 10-K, 10-Q, 485BPOS, etc). The document type is limited to the same value as the supporting SEC submission type, or the word 'Other'.
+ References
+ Details
Name: |
dei_DocumentType |
Namespace Prefix: |
dei_ |
Data Type: |
dei:submissionTypeItemType |
Balance Type: |
na |
Period Type: |
duration |
|
X |
- DefinitionAddress Line 1 such as Attn, Building Name, Street Name
+ References
+ Details
Name: |
dei_EntityAddressAddressLine1 |
Namespace Prefix: |
dei_ |
Data Type: |
xbrli:normalizedStringItemType |
Balance Type: |
na |
Period Type: |
duration |
|
X |
- DefinitionAddress Line 2 such as Street or Suite number
+ References
+ Details
Name: |
dei_EntityAddressAddressLine2 |
Namespace Prefix: |
dei_ |
Data Type: |
xbrli:normalizedStringItemType |
Balance Type: |
na |
Period Type: |
duration |
|
X |
- Definition
+ References
+ Details
Name: |
dei_EntityAddressCityOrTown |
Namespace Prefix: |
dei_ |
Data Type: |
xbrli:normalizedStringItemType |
Balance Type: |
na |
Period Type: |
duration |
|
X |
- DefinitionCode for the postal or zip code
+ References
+ Details
Name: |
dei_EntityAddressPostalZipCode |
Namespace Prefix: |
dei_ |
Data Type: |
xbrli:normalizedStringItemType |
Balance Type: |
na |
Period Type: |
duration |
|
X |
- DefinitionName of the state or province.
+ References
+ Details
Name: |
dei_EntityAddressStateOrProvince |
Namespace Prefix: |
dei_ |
Data Type: |
dei:stateOrProvinceItemType |
Balance Type: |
na |
Period Type: |
duration |
|
X |
- DefinitionA unique 10-digit SEC-issued value to identify entities that have filed disclosures with the SEC. It is commonly abbreviated as CIK.
+ ReferencesReference 1: http://www.xbrl.org/2003/role/presentationRef -Publisher SEC -Name Exchange Act -Number 240 -Section 12 -Subsection b-2
+ Details
Name: |
dei_EntityCentralIndexKey |
Namespace Prefix: |
dei_ |
Data Type: |
dei:centralIndexKeyItemType |
Balance Type: |
na |
Period Type: |
duration |
|
X |
- DefinitionIndicate if registrant meets the emerging growth company criteria.
+ ReferencesReference 1: http://www.xbrl.org/2003/role/presentationRef -Publisher SEC -Name Exchange Act -Number 240 -Section 12 -Subsection b-2
+ Details
Name: |
dei_EntityEmergingGrowthCompany |
Namespace Prefix: |
dei_ |
Data Type: |
xbrli:booleanItemType |
Balance Type: |
na |
Period Type: |
duration |
|
X |
- DefinitionCommission file number. The field allows up to 17 characters. The prefix may contain 1-3 digits, the sequence number may contain 1-8 digits, the optional suffix may contain 1-4 characters, and the fields are separated with a hyphen.
+ References
+ Details
Name: |
dei_EntityFileNumber |
Namespace Prefix: |
dei_ |
Data Type: |
dei:fileNumberItemType |
Balance Type: |
na |
Period Type: |
duration |
|
X |
- DefinitionTwo-character EDGAR code representing the state or country of incorporation.
+ References
+ Details
Name: |
dei_EntityIncorporationStateCountryCode |
Namespace Prefix: |
dei_ |
Data Type: |
dei:edgarStateCountryItemType |
Balance Type: |
na |
Period Type: |
duration |
|
X |
- DefinitionThe exact name of the entity filing the report as specified in its charter, which is required by forms filed with the SEC.
+ ReferencesReference 1: http://www.xbrl.org/2003/role/presentationRef -Publisher SEC -Name Exchange Act -Number 240 -Section 12 -Subsection b-2
+ Details
Name: |
dei_EntityRegistrantName |
Namespace Prefix: |
dei_ |
Data Type: |
xbrli:normalizedStringItemType |
Balance Type: |
na |
Period Type: |
duration |
|
X |
- DefinitionThe Tax Identification Number (TIN), also known as an Employer Identification Number (EIN), is a unique 9-digit value assigned by the IRS.
+ ReferencesReference 1: http://www.xbrl.org/2003/role/presentationRef -Publisher SEC -Name Exchange Act -Number 240 -Section 12 -Subsection b-2
+ Details
Name: |
dei_EntityTaxIdentificationNumber |
Namespace Prefix: |
dei_ |
Data Type: |
dei:employerIdItemType |
Balance Type: |
na |
Period Type: |
duration |
|
X |
- DefinitionLocal phone number for entity.
+ References
+ Details
Name: |
dei_LocalPhoneNumber |
Namespace Prefix: |
dei_ |
Data Type: |
xbrli:normalizedStringItemType |
Balance Type: |
na |
Period Type: |
duration |
|
X |
- DefinitionBoolean flag that is true when the Form 8-K filing is intended to satisfy the filing obligation of the registrant as pre-commencement communications pursuant to Rule 13e-4(c) under the Exchange Act.
+ ReferencesReference 1: http://www.xbrl.org/2003/role/presentationRef -Publisher SEC -Name Exchange Act -Number 240 -Section 13e -Subsection 4c
+ Details
Name: |
dei_PreCommencementIssuerTenderOffer |
Namespace Prefix: |
dei_ |
Data Type: |
xbrli:booleanItemType |
Balance Type: |
na |
Period Type: |
duration |
|
X |
- DefinitionBoolean flag that is true when the Form 8-K filing is intended to satisfy the filing obligation of the registrant as pre-commencement communications pursuant to Rule 14d-2(b) under the Exchange Act.
+ ReferencesReference 1: http://www.xbrl.org/2003/role/presentationRef -Publisher SEC -Name Exchange Act -Number 240 -Section 14d -Subsection 2b
+ Details
Name: |
dei_PreCommencementTenderOffer |
Namespace Prefix: |
dei_ |
Data Type: |
xbrli:booleanItemType |
Balance Type: |
na |
Period Type: |
duration |
|
X |
- DefinitionTitle of a 12(b) registered security.
+ ReferencesReference 1: http://www.xbrl.org/2003/role/presentationRef -Publisher SEC -Name Exchange Act -Number 240 -Section 12 -Subsection b
+ Details
Name: |
dei_Security12bTitle |
Namespace Prefix: |
dei_ |
Data Type: |
dei:securityTitleItemType |
Balance Type: |
na |
Period Type: |
duration |
|
X |
- DefinitionName of the Exchange on which a security is registered.
+ ReferencesReference 1: http://www.xbrl.org/2003/role/presentationRef -Publisher SEC -Name Exchange Act -Number 240 -Section 12 -Subsection d1-1
+ Details
Name: |
dei_SecurityExchangeName |
Namespace Prefix: |
dei_ |
Data Type: |
dei:edgarExchangeCodeItemType |
Balance Type: |
na |
Period Type: |
duration |
|
X |
- DefinitionBoolean flag that is true when the Form 8-K filing is intended to satisfy the filing obligation of the registrant as soliciting material pursuant to Rule 14a-12 under the Exchange Act.
+ ReferencesReference 1: http://www.xbrl.org/2003/role/presentationRef -Publisher SEC -Name Exchange Act -Section 14a -Number 240 -Subsection 12
+ Details
Name: |
dei_SolicitingMaterial |
Namespace Prefix: |
dei_ |
Data Type: |
xbrli:booleanItemType |
Balance Type: |
na |
Period Type: |
duration |
|
X |
- DefinitionTrading symbol of an instrument as listed on an exchange.
+ References
+ Details
Name: |
dei_TradingSymbol |
Namespace Prefix: |
dei_ |
Data Type: |
dei:tradingSymbolItemType |
Balance Type: |
na |
Period Type: |
duration |
|
X |
- DefinitionBoolean flag that is true when the Form 8-K filing is intended to satisfy the filing obligation of the registrant as written communications pursuant to Rule 425 under the Securities Act.
+ ReferencesReference 1: http://www.xbrl.org/2003/role/presentationRef -Publisher SEC -Name Securities Act -Number 230 -Section 425
+ Details
Name: |
dei_WrittenCommunications |
Namespace Prefix: |
dei_ |
Data Type: |
xbrli:booleanItemType |
Balance Type: |
na |
Period Type: |
duration |
|
CareTrust REIT (NYSE:CTRE)
Gráfica de Acción Histórica
De May 2024 a Jun 2024
CareTrust REIT (NYSE:CTRE)
Gráfica de Acción Histórica
De Jun 2023 a Jun 2024